SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053531 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053531
Domain Number 1 Region: 714-788,831-1044
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.58e-80
Family Protein kinases, catalytic subunit 0.00000000248
Further Details:      
 
Domain Number 2 Region: 125-296
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.96e-72
Family Ephrin receptor ligand binding domain 0.00000141
Further Details:      
 
Domain Number 3 Region: 421-625
Classification Level Classification E-value
Superfamily Fibronectin type III 5.41e-35
Family Fibronectin type III 0.00016
Further Details:      
 
Domain Number 4 Region: 1049-1121
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.75e-20
Family SAM (sterile alpha motif) domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053531   Gene: ENSBTAG00000044111   Transcript: ENSBTAT00000061591
Sequence length 1126
Comment pep:known_by_projection chromosome:UMD3.1:1:40608729:41623778:1 gene:ENSBTAG00000044111 transcript:ENSBTAT00000061591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFRSPTAARSSLAPQAASSSEAAAPAPGQPGPSCPAPGASRGGRPGTPTVGRVEEEEEE
EEDVDRDPTLNTWLRCCHFSLRGRRREPGRTMGGSEVREFLLQFGFFLPLLTAWPGDCSH
VSNNQVVLLDTTTVLGELGWKTYPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNWLRT
NWISRDAAQKIYVEMKFTLRDCNSIPWVLGTCKETFNLYYVESDESHGIKFKPSQYTKID
TIAADESFTQMDLGDRILKLNTEIRELGPIERKGFYLAFQDIGACIALVSVRVFYKKCPF
TVRNLAVFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTGY
EEIEGSCHGKKNTFKLFMHSNDGFSDNTHSLTYVEATSVCQCEKGYFRAEKDPPSMACTR
PPSAPRNVVFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIP
RHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDAPSLIGMVR
KDWASQNSIALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIITGLKPATR
YIFHIRVRTAAGYSGYSQKFEFETGDETSDMAAEQGQILVIATAAVGGFTLLVILTLFFL
ITGRCQWYIKAKMKSEEKRRKDLQNGHLRFPGIKTYIDPDTYEDPSLAIHEFAKEIDPSR
IRIERVIGAGEFGEVCSGRLKTPGKREIPVAIKTLKGGHMDRQRRDFLREASIMGQFDHP
NIIRLEGVVTKRSFPAIGVETFCPSFLRAGFLNSLQAPHPAPGGGSLPPRIPAGRPVMIV
VEYMENGSLDSFLRKHDGHFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILVNSNL
VCKVSDFGLSRVLEDDPEAAYTTTGGKIPIRWTAPEAIAYRKFSSASDAWSYGIVMWEVM
SYGERPYWEMSNQDVILSIEEGYRLPAPMGCPASLHQLMLHCWQKERNHRPKFTDIVSFL
DKLIRNPSALHTLVEDILVMPDSPGEVPEYPLFVTVGDWLDSIKMGQYKNNFMAAGFTTF
DLISRMSIDDIRRIGVILIGHQRRIVSSIQTLRLHMMHIQEKGFHV
Download sequence
Identical sequences F1MQH2
ENSBTAP00000053531 ENSBTAP00000053531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]