SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053566 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053566
Domain Number 1 Region: 1816-1924
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-28
Family Cadherin 0.00074
Further Details:      
 
Domain Number 2 Region: 2126-2237
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-28
Family Cadherin 0.00085
Further Details:      
 
Domain Number 3 Region: 1075-1180
Classification Level Classification E-value
Superfamily Cadherin-like 7.33e-28
Family Cadherin 0.0014
Further Details:      
 
Domain Number 4 Region: 1601-1709
Classification Level Classification E-value
Superfamily Cadherin-like 8.9e-27
Family Cadherin 0.0016
Further Details:      
 
Domain Number 5 Region: 2575-2736
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-26
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 6 Region: 867-974
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 1913-2029
Classification Level Classification E-value
Superfamily Cadherin-like 2e-23
Family Cadherin 0.003
Further Details:      
 
Domain Number 8 Region: 2225-2342
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-23
Family Cadherin 0.0013
Further Details:      
 
Domain Number 9 Region: 352-467
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 10 Region: 39-147
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-21
Family Cadherin 0.0029
Further Details:      
 
Domain Number 11 Region: 1284-1394
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 12 Region: 245-357
Classification Level Classification E-value
Superfamily Cadherin-like 4.84e-21
Family Cadherin 0.0022
Further Details:      
 
Domain Number 13 Region: 1711-1822
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-20
Family Cadherin 0.0049
Further Details:      
 
Domain Number 14 Region: 974-1081
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-19
Family Cadherin 0.0026
Further Details:      
 
Domain Number 15 Region: 561-681
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-19
Family Cadherin 0.002
Further Details:      
 
Domain Number 16 Region: 1181-1279
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-19
Family Cadherin 0.0022
Further Details:      
 
Domain Number 17 Region: 465-567
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-19
Family Cadherin 0.0022
Further Details:      
 
Domain Number 18 Region: 1382-1490
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-17
Family Cadherin 0.0026
Further Details:      
 
Domain Number 19 Region: 2024-2124
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-17
Family Cadherin 0.0025
Further Details:      
 
Domain Number 20 Region: 1498-1608
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000999
Family Cadherin 0.0044
Further Details:      
 
Domain Number 21 Region: 157-257
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000327
Family Cadherin 0.01
Further Details:      
 
Domain Number 22 Region: 669-790
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000971
Family Cadherin 0.0061
Further Details:      
 
Domain Number 23 Region: 776-879
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000007
Family Cadherin 0.0019
Further Details:      
 
Domain Number 24 Region: 2339-2430
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000327
Family Cadherin 0.019
Further Details:      
 
Domain Number 25 Region: 1-51
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000612
Family Cadherin 0.0054
Further Details:      
 
Domain Number 26 Region: 2759-2802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 27 Region: 2799-2839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000203
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053566   Gene: ENSBTAG00000003498   Transcript: ENSBTAT00000061431
Sequence length 3160
Comment pep:known chromosome:UMD3.1:7:64703774:64769031:-1 gene:ENSBTAG00000003498 transcript:ENSBTAT00000061431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLLATARQLDRENKDEHILEVTVLDNGEPSLRSTSRVVVRIADVNDNPPVFSHKLFNVRL
PERLNPGTSGPVYRLVASDLDEGLNGRVTYSIEESDEAGFSIDPVTGVVSASSTFTAGEY
NILTVKATDGGQPPLSASVRLHIEWIPKPRPSSIPLAFDESHYSFTVMETDPVNHMVGVI
SVEGRPGLFWFSISGGDKDMDFDIEKTTGSIVIARPLDTRRRSSYNLTVEVTDGFQTIAT
QVYIVMIANVNHHRPQFLEAHYEVRVPQDTMPGVELLRVQATDQDKGKGLIYTIHGSQDP
GSASLFQLDPSSGVLVTVGKLDLGSGPSQHTLTVMVRDQEMPIKRNFVWVSIHVEDGNLH
PPRFTQLHYETRVSDTTVPGAELLQVRAMDGDRGANAEVHYSFLKGNSEGFFNINALLGI
ITLAQKLDQANHARYTLTVKAEDQGSPQGHDLATVIIHVYPSDSSAPIFSNSEYFVEIPE
SIPVGSPILLISATSFSEVTYELREGNKNGVFSMNSYSGLISTQKKLDHEKISSYQLKIR
GSNMAGTFTDVMVLVYIIDENDNAPVFSKSTFVGQISEAAPLNSMIMDENNNPLVIRASD
SDKEANSLLVYKILEPETLKFLKIDPSMGTLTTVLEMDYESMPSFRFDIYVHDQGSPILF
APRAAQVIINVRNVNDCPPRFLDQIYEVAIMKPIHRGMELLMVQASDDDSEVTYSIKTGN
ADEAIAMHPITGRISVLDPTLLGLSRELIIRASDGLYQDTALVKISWTQASNTTLQFDRD
VYRATVKENLLERKALVILGAQGNHLNDTLSYFLLNGTDMFHMIKSAGVLQTRGVGFDRE
QQDTHEVAVELRDNRTPQRVAQALVRVSVEDVNDNSPEFKHLPYHTIIQDGTEPGDVLFQ
VSATDQDLGVNGAVTYAFAEDYTYFRIDPYLGDISLRKPFDYQALNKYRLKVIAQDGGTP
SLQAEEEVLVIVRNKSNPLFQTPYYKVRVPENITLYTPILHTQARSPEGLRLIYNIVEEE
PLMLFTTDFKTGVLTVTGPLDYESKTKHVFTVRATDTALGSFSEATVEVLVEDVNDNPPT
FSQLVYTTSISEGLPAQTPVIQLLASDQDSGQNRDVSYQIVEDGSDVSKFFQINGSTGEM
STVQELDYEAQQHFHVKVRAMDRGDPPLTGETLVVVNVSDINDNPPEFRQPHYEANVSEL
ATCGHLVLKVQALDPDSRDTSRLEYLILSGNQDRHFSINSSSGIISMYNLCKKHLDSSYN
LRVGASDGVFRATVPVYINTTNANKYSPEFQQHIYEAELAENAKVGTKVIELLAIDKDSG
PYGTVDYTIINKLAGEKFSINPSGQITTLQKLDRENSTERVIAIKVMAQDGGGRVAFCTV
KIILTDENDNPPQFKASEYTVSIQSNVSKDSPVIQVLAYDADEGRNADVTYSVDSVEDLE
EEVIEVNPITGVVKVKESLVGLENRAFDLKIKAQDGGPPHWNSLMLLRLQVVPNEVSLPQ
FSEPLYTFSASEDLPEGSEIGSVKAVAGQDPVIYSLVQGTTPESNKDGIFSLDQNTGVLK
VRKAMDYESTKWYQIDLMAHCPHNDTYLGSLVSVNIQVKDVNDNRPIFEADPYKAVLTEN
MPVGTSVIQVTANDQDTGDDGQVSYRLPVDPGSNIHELFAIDSETGWITTLQELDCETNQ
IYHFYVVAYDHGRTIQLSSQVLVEVSITDENDNAPRFASEDYRGSVVENSEPGEPVATLK
TLDADIAEQNRQVTCYITEGDPLGQFGISQVGDEWRIFSRKTLDREHTAKYLLRITASDG
KFQASVPVEIFVLDINDNSPQCSQLLYTGKVSEDVPPEHFILKVSATDLDSDTNAQITYS
LHGPGADEFKLDPHTGDLTTLTALDREKKDVYSLVAKATDGGGQSCQADVTLHVEDVNDN
APRFFPSHSAVAVFDNTTVKTPVAVVLARDPDQGTNAQVVYSLTDSAEGHFSIEATTGVI
RLEKPLQVRPQAALELTVRASDLGTPIPLSTLGTVTVSVVGLEDYLPVFLSTEHSVQVPE
DAQRGTEVLRLATLTRPGAEKTGYRVVSGNEQGRFRLDARTGILYVNKSLDFETSPKYFL
SVECSRKGSSSLSDMTTIVVNITDINEHRPRFPQHLYSTRVLENAIVGDVVLTVSATDED
GPVNSAITYSLIGGNQLGHFAIHPKKGELQVAKALDWEQTSSYSLKLRATDSGQPALYED
TDIAIQVVDVNDNPPRFFQLNYSTSVQENAPIGSKVLQLILSDPDSPENGPPFSFRITKG
NDGFAFRVTPDGWLVTTAGLSKRVQEWYKLQIEVSDSGIPPLSSSTSVKVHVREQSHYPP
SALPLEIFITIGEEEFQGGMVGKIHATDRDPQDTLTYSLAGEESVGQRFSVGATDGKIIA
SHTLPRGRYTFNVTVSDGTFSTMAGVHVHVWHMGPEALQQTMWMGFHQLTPEELVSDHWR
NLQRFLSNWLDIKRANIHLASLQPAEATAGVDVLLVFEGHLGAFSKLQELASTIARSAKE
MEHSVGIQMRSAMPVVPCQGPSCQGQICQETVHLDPRVGPTYSTARLSILTPRHRLEKNC
SCKGTAVRFSGQSFGRYRLPEFQNGHIHFRLKTLQSQAILLFSNKTVRLSLKLVNGVLQL
EYHCPGGFYGNLSSRLHVNDHEWHSVLVEEMDTSVRLLVDSASSTSLKLPENCRGLKPER
DLFLGGLVHSHSSPNVSQGFEGCLDAVVINREVLELLVHGKKAAGLLERRALTECCFPSD
QCGQNPCLNGGKCSQTGGAGYICVCRPQFAGRHCEQRKENCTSTPCLEGGTCISSPEGAP
CICPHPYTGDRCEMEARGCSEGHCLVTPEITRGDWGQQEILIIIVALLVIVVISTVLLFY
CRRCKSHKPVAMEDPDLLARSVGVDTQAMPAIELNPLSTSSCNNLNQTEPGKTSAPNELG
TFGPSSKQRPMVCSVPPRLPPAAVSSHPDSEAIIKRRWSGEEMVYPGGATVWPPTYSGKE
RWEYPHSEVTPGPVPPSPHCHQNPAVMPDPSGLYGGFPFPLELENKRAPLPPRYSNQNLE
DLIPPRPPSPREHLPAPCLNEYTAISYYHSQFRQGGGGPCLAEGGYKGVSMRLSRAGPSY
ADCEVGGGHPLGRGQPQAPPSYEGSDMVESDYGSCEEVMF
Download sequence
Identical sequences F1MPF3
ENSBTAP00000053566 ENSBTAP00000053566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]