SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053569 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053569
Domain Number 1 Region: 2111-2411
Classification Level Classification E-value
Superfamily BEACH domain 1.7e-129
Family BEACH domain 0.0000000000166
Further Details:      
 
Domain Number 2 Region: 2520-2771
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.35e-33
Family WD40-repeat 0.0073
Further Details:      
 
Domain Number 3 Region: 114-299
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.24e-31
Family Clostridium neurotoxins, the second last domain 0.014
Further Details:      
 
Domain Number 4 Region: 2000-2105
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-29
Family PreBEACH PH-like domain 0.00000274
Further Details:      
 
Domain Number 5 Region: 397-498,578-869
Classification Level Classification E-value
Superfamily ARM repeat 3.78e-18
Family Mo25 protein 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053569   Gene: ENSBTAG00000018546   Transcript: ENSBTAT00000061161
Sequence length 2786
Comment pep:known_by_projection chromosome:UMD3.1:17:6871712:7542666:1 gene:ENSBTAG00000018546 transcript:ENSBTAT00000061161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVGGQFDLEMNFIIQEGESIICMVDLLEKCDVTCQAEVWSMFTAILKKSIRNLQICTEVG
LVEKVLGKIEKVDSMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGQWPPHAGKLLS
VLKHMPQKYGPDAFFNFPGKSAAAIALPPVAKWPYQNGFTFHTWLRMDPVNNINVDKDKP
YLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFDFKPQKWYMVTVVHIYNRWK
NSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQMTAVYLFSEALN
AAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSAIAFTYNPRATDAQLCL
ESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSVGGVQVLFPLFAQLDYKQYLSDE
IDSTICSTLLAFIMELLKNSIAMQEQMLACKGFLVIGYSLEKSSKSHVSRAVLELCLVFS
KYLSNLPNGMPLLKQLCDHILLNPALWIHTPAKVQLTLYTYLSTEFIGTVNIYNAIRRVG
TVLLIMHTLKYYYWAVNPQDRSGITPKGLEDGPRPNQKEMFSLRAFLLMFIKQLVMKDNG
VKEDELQAILNYLLTMHEDDNLMDVLQLLVALMSEHPNSMIPAFDQRNGLRVIYKLLAST
SEGIRVQALKAMGYFLKHLAPKRKAEVMLGHGLFSLLAERLMLQTNLITMTTYNVLFEIL
IEQICTQVIHKQHPDPDSSVKIQNPQILKVIATLLRNSVQCPESMEVRRAFLSDMIKLFN
NSRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYHAIKYEWGGWRV
WVDTLSITHSKVTFEIHKENLASILREHQGKVDEETGHCSSSPVQAVSGISREVNVSVGS
QQSDTKDSPVSSDITRNSDEKSSIGQTSSVESASNTELQIPATSDEERTTGPENEELLDE
VPLEETLINETVNADNLDGSSDITEAATISSDSFTTGKDTVTVNEVTASISSPSEEDASE
VPELLEKSIVEEDDDDYVELKVECSPIEEASLPTEPQDNSLSPGASEASERGDVFSNDHK
LIFQEEEAVSKKQTDSETQDPEDSGILPMTAPGTSVTPADVTASQAAVHPDIAHTLEERE
KTNSTGETKLNSDSHGNIFESPTTSEHKIAKLDVSSVATDTERLELKANTNMEVSQPPQP
ALEMSRQQEQPGQGTADTVNGQRRDSRSMFRIPEFRWSQMHQRLLTDLLFSIETDIQMWR
SHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEP
TQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKNMSSGGILRQSLRLVCAVAVRN
CLECQQQSQLRSKGETGKSQKMAHSLIPTGKSAAKSPVDLVTGGISPVRDFDRLLQDMDI
NRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEPQNERHSQSRETGSECGNL
SLPAVKIFILEFKSICVYINESMQLVLLITNYRCIVREAANIGVAPPQQFGGPLSPIGVS
KSEYLSKDLNCTGCSAERSPRAPRQAGGRRAGSTVTPSAVVCNNVNIPVIWQCYANMVAN
SVKIFCAFMIPSVVGLCGWTSVVNFLLLLSFHQSVIVATKKSAVLPSTLTGIPTNAVSVV
SSVDSAQASDVGGESPEGRTPKSESMLCCHHLSIKNKFPAAYLLIIITERLEHALEKAAP
LLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKN
AGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESKSLCAQYSAD
KREDEKMCDHLIRAAKYRDHVTATQLIQKIINILTDKHGAWGNSAVSRPREFWRLDYWED
DLRRRRRFVRNPLGSTHPEATLKTAVEHAADEDILAKGKQSIKSQALGNQNSENETLLEG
DDDTLSSMDEKDLENLTGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKI
DPKILAYTEGLHGKWLFSEIRSIFSRRYLLQNTALEIFMANRVAIMFNFPDPATVKKVVN
YLPRVGIGTSFGLPQTRRISLASPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRTYN
DLNQYPVFPWVITNYESEELDLTLPSNFRDLSKPIGALNPKRAAFFAERYESWEDDQVPK
FHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSISRAWRNSQRDTSDIK
ELIPEFYYLSEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVRINRLALESEFVSC
QLHQWIDLIFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVKAQIRSFGQTP
SQLLIEPHPPRGSAMQASPLMFTDQAQQDVIMVLKFPSNSPVTHVAANTQPGLATPAVIT
VTANRLFAMNKWHNLPAHQGAVQDQPYQLPVEIDPLIASNTGMHRRQITDLLDQSIQVHS
QCFVITSDNRYILLCGFWDKSFRVYSTDTGKLIQVVFGHWDVVTCLTRSESYIGGNCYIL
SGSRDATLLLWYWNGKSSGIGDNPGKGETATPRAILTGHDYEITCAAVCAELGLVLSGSK
EGPCLIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGSFCTFSVNGKLQATME
TDDNIRAIQLSRDGQYLLTGGDSGVLMVWQVSDLKQLFAYPGCDAGIRAMALSYDQRCVI
AGMASGSIVLFYNDFNRWHHEYQTRY
Download sequence
Identical sequences E1BND6
ENSBTAP00000053569 ENSBTAP00000053569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]