SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053616 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053616
Domain Number 1 Region: 228-347,411-484
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.52e-17
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 2 Region: 6-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.05e-16
Family Clostridium neurotoxins, the second last domain 0.041
Further Details:      
 
Domain Number 3 Region: 355-455,489-507
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000000216
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 4 Region: 1277-1344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000306
Family Complement control module/SCR domain 0.0056
Further Details:      
 
Domain Number 5 Region: 1208-1280
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000347
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 6 Region: 1146-1212
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000117
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 7 Region: 1076-1150
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000306
Family Complement control module/SCR domain 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000053616
Domain Number - Region: 539-569,748-802
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000159
Family Fibronectin type III 0.0064
Further Details:      
 
Domain Number - Region: 1416-1445
Classification Level Classification E-value
Superfamily Notch domain 0.0405
Family Notch domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053616   Gene: ENSBTAG00000004010   Transcript: ENSBTAT00000061502
Sequence length 1489
Comment pep:known_by_projection chromosome:UMD3.1:8:107150317:107379748:1 gene:ENSBTAG00000004010 transcript:ENSBTAT00000061502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLYDKCSYASRDRGWVVGIHTVSDQGNRDPRYFFSLKTDRARQVTTINAHRSYLPGQWVY
LAATYDGRLMKLYMNGAQVATSGEQVGGIFSPLTQKCKVLMLGGSTLNHNYRGSVERFSL
WKVARTQREILLDMGTRGPQGPLPQLLLQENWDNVKRAWSPMKDGSSPRVEVSGAHGFRL
DTSLEPPLCGQTLCDSPEVIANYNQLPRLRQPKVVRYRVVNLHDDGRENPTVSRQQIDFQ
HQQLAEAFKHYNISWELEVLEVSNSSLRRRLILANCDISKIGDENCDPECNHTLTGHDGG
DCRHLRHPAFAKKQQNGVCDMDCNYERFNFDGGECCDPNITDVTKTCFEPDNLHRAYLDV
NEMKNILRLDGSTHLNIFFANSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGIPGHTH
TMIHEIGHSLGLYHIFRGISEIQSCSDPCMETEPSYETGDLCSDTNPAPKHKFCGDPGPG
NDTCGFNSFFNTPYNNFMSYADDDCTDSFTPNQVARMHCYLDLVYQGWQPSRKPAPIALT
PQVVSHMPDSVMLEWFPPIDGHFFERELGSACDLCLEGRFLVQYAFNASSPMPCGPSGHW
SPREAEGHPDVEQPCKSSVRTWSPNSAVNPHTVPPACPEPQGCHLDLRFRYPLVPESLTV
WVTFVSTDWDSSGAVNDIKLLGVSGNNISLGPQNVFCDVPLTIKLQDVGEEVYGVQIYTL
DEHLEIDAAMLTSVADSPLCLECKPLQYKVVRDPPLQVDVASTLHFSRRFTDTDVHLGSR
YQYWVIAISGNEESEPSPAATYIHGSGYCGDGIIQRSQGEECDDMNKINGDGCSLFCRQE
VSFNCIDEPSRCYFHDGDGVCEEFEQKTSIKDCGVYTPQGFLDQWASNATVSHQDQQCPG
WVIIGQPAASQVCRTKVIDLSEGISQHAWYPCTISYPYSQLAQTTFWVRAYFSQPMVATA
VIVHLVTDGTYYGDQKQETISVQLLDTNEQSHDLGFHVLSCRNNPLIIPVVHDLSQPFYH
SQAVRVSFSSPLVAISGVALRSFDNFDPVTLSSCQRGETYSSAEQSCVHFACEAADCPKL
AVENASLNCSSSDGYHGAQCAVRCRTGYVLQIQRDDELIKSQTGPSVTVTCKEGKWNKQV
ACEPVDCGVPDQHHVYAASFSCLEGTTFGSKCSFQCRHPAQLKGNNSLLTCMEDGLWSFP
EALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCRPGYHVPGSSRKSKKRAFKTQ
CTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRINCEDSDATQGRGNNVIHC
RKDGTWSGSFHICQEMQGECSAPDQLNSNLKLQCPEGYAIGSECTTSCLDHNSESIVLPV
NVSVRDIPHWLNPTRVQRVVCTAGLKWYPHPALIYCVKGCEPFMGDNYCDAINNRAFCNY
DGGDCCASTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLRGYSHG
Download sequence
Identical sequences F1N7Z6
ENSBTAP00000053616 ENSBTAP00000053616 9913.ENSBTAP00000053616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]