SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053639 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053639
Domain Number 1 Region: 38-227
Classification Level Classification E-value
Superfamily L domain-like 2.04e-28
Family Ngr ectodomain-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053639   Gene: ENSBTAG00000043983   Transcript: ENSBTAT00000061341
Sequence length 370
Comment pep:known_by_projection chromosome:UMD3.1:8:17241724:17245917:1 gene:ENSBTAG00000043983 transcript:ENSBTAT00000061341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTMSITILFWLLSMLLLSDKSQTSKTEVKCNSTAKNYSLIPANISKNVTILDLSYNQIT
LNITDTRVLQTYFLLSELYLVENKVTNLFNNSFSNLSNLEILNICRNSIHTIQQSAFTGL
HKLKKLYLCQNKIVQLNPKTFLPLKNLILLNLHGNLISYFDVPQLFHLEFIILYGNPWNC
SCSLLNLQNWLKTSNVTLENESITMCSYPDILKCYNIKTVPYKAECYSKFPSSITEDLHI
PFQSISNSTFNNSLNNLTRNSEHESHGKSWAFLVGVVVAVVMTSLLISIAIKCPVWYNFL
LSYNHHRLEEHEAETYEDSFTGNPSSPSQIPDTNSEETTVIFDQLHSFVVDDDGFIEDKY
IDTHELREEN
Download sequence
Identical sequences E1BMK6
NP_001178196.1.59421 NP_001178196.1.76553 XP_005209939.1.76553 XP_005209940.1.76553 XP_005904865.1.15283 XP_010851628.1.44457 XP_010851629.1.44457 XP_010851630.1.44457 XP_010851631.1.44457 XP_019821425.1.53367 XP_019821426.1.53367 XP_019821427.1.53367 ENSBTAP00000053639 ENSBTAP00000053639 9913.ENSBTAP00000053639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]