SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053642 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053642
Domain Number 1 Region: 779-847
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000111
Family IBR domain 0.0000163
Further Details:      
 
Domain Number 2 Region: 65-166
Classification Level Classification E-value
Superfamily PUG domain-like 0.000000000000484
Family PUG domain 0.0042
Further Details:      
 
Domain Number 3 Region: 696-757
Classification Level Classification E-value
Superfamily RING/U-box 0.000000283
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 4 Region: 859-930
Classification Level Classification E-value
Superfamily RING/U-box 0.00000556
Family RING finger domain, C3HC4 0.031
Further Details:      
 
Domain Number 5 Region: 349-375
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000314
Family Ran binding protein zinc finger-like 0.003
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000053642
Domain Number - Region: 572-611
Classification Level Classification E-value
Superfamily UBA-like 0.000129
Family UBA domain 0.01
Further Details:      
 
Domain Number - Region: 299-325
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00034
Family Ran binding protein zinc finger-like 0.0027
Further Details:      
 
Domain Number - Region: 217-253,318-432
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00738
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053642   Gene: ENSBTAG00000005815   Transcript: ENSBTAT00000061147
Sequence length 1070
Comment pep:known chromosome:UMD3.1:10:20826444:20837713:-1 gene:ENSBTAG00000005815 transcript:ENSBTAT00000061147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEEEKRAFLEAREELASALRRDSGQAFTQEQLWPLLGTSLPPEARYLQLDAARLVRCN
AHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLR
LYGYTEEQPDGLSFPERQEEPDQQQVATVTLEVLLLRTELNLLLQNAHPKPQALEQLLKD
KVEDDLLQLSEFAPLLREIAPSPLTIPSAAGSTPAPCFLCGSAPGTLHCSACKQALCLTC
DRLFHGHPERAHHHRQTLHGAPQAVHPSLPASAPPRPQPASGPTLGDSSFSPPDPASARL
LWPCSACALLNEPWAVLCVACDRPRGCKGLGPGIEGPQGTGGLEPELSRGHWACQSCTFE
NEAAAVLCAICERPRLAQPPSLVVDSQDSGICLKPLQQGDTVLSPVQTPAWYCIHCTFCN
SGPGWVCAMCNRTSSPVPVQQTPQPHASSLEERHPEPGPPRPLHAPVTSSCGDLEKQRQD
KMREEGLQLVLKIREGEAGGACPEEVFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQ
DPGLGAFSCQEARKAWLDRHGNLDEAVEECVRTRRRKVQELRSLGFEPEEGSLQALFQHG
GDVARALTELQRQRLEPFHQRLWDSGPEPTPSWDGPDKQSLVRRLLAVHSLPSWGRAELA
LALLQETPRNYELGDVVEAVRQSQDRAFLRRLLAQECAVCSWVLPRNRMQSLTSCECTIC
PDCFRQHFTIALKEKHITDMACPGCGRPDLTDDTQLLGYFSTLDIQLRESLEPDAYALFH
KKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCQQTFCVRCKRQWEEQHRGRSCE
DFQNWKRTNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCY
SAFYAKNKCPDPNCRVKKSLHGHHPRDCLFYLRDWSAVRLQKLLQDNNVMFNTEPPVGAR
AVPGGGCRVMEQKEVPNGFRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYE
LEELETAAERYLHVRPQALPGEDAPTYHARLLQKLIEEVPLGQSIPRRRK
Download sequence
Identical sequences E1BMK3
XP_005211350.1.76553 XP_019823845.1.53367 ENSBTAP00000053642 9913.ENSBTAP00000053642 ENSBTAP00000053642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]