SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053650 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053650
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 2.09e-50
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1079-1192
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-19
Family SPRY domain 0.026
Further Details:      
 
Domain Number 3 Region: 4002-4080
Classification Level Classification E-value
Superfamily EF-hand 0.00000000077
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 4 Region: 657-805
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000673
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 98-180
Classification Level Classification E-value
Superfamily MIR domain 0.00000301
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 422-546
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000366
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 2145-2210
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000981
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053650   Gene: ENSBTAG00000022886   Transcript: ENSBTAT00000061611
Sequence length 4960
Comment pep:known_by_projection chromosome:UMD3.1:28:9965916:10567329:1 gene:ENSBTAG00000022886 transcript:ENSBTAT00000061611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMMKWSCSVPRPSTKNNRNYAWRQKDLATDFASWSPLRIPRMSLQTSPSAPSCWSSPCLS
GPCRRCWLTLWKSLKGQVLNLFFLCSMQTAQGGGHRTLLYGHAILLRHSYSGMYLCCLST
SRSSTDKLAFDVGLQEDTTGEACWWIIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLS
YGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHMDECLTVPSGEHGEE
QRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKSLL
LMDKEKADVKSTAFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSVCYIQHINTGLWLTYQ
SVDVKSVRMGSIQRKAIMHHEGHMDDGLNLSRSQHEESRTARVIRSTVFLFNRFIRGLDA
LSKKVKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMI
NLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQFSGSL
DWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLC
SLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYY
ELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSG
CIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFS
AGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYKQERTYTRDLLGPTV
SLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQH
PCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEEKVKKMKLPKNYQLTSG
YKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPY
ALLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSGTGERFRIFRAEKTYA
VKAGRWYFEFEAVTAGDMRVGWCRPGCQPDQELGSDERAFAFDGFKAQRWHQGNEHYGRS
WQAGDVVGCMVDMTEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRL
NFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEHIEVTRIDG
TIDSSPCLKVTQKSFGSQNSSTDIMFYRLSMPIECAEVFSKTAAGGIPGTGLFGPKNDLE
DYDVDSDFEVLMKTAHGHLVPDRGDRDKEATKPEFNNHKDYAQEKPSRLKQRFLLRRTKP
DYSTSHSARLTEDVLADERDDYDYLMQTSTYYYSVRIFPGQEPANVWVGWITSDFHQYDT
GFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESLSPGQGRNNNGLEIGCVVDAAS
GLLTFTANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEH
KNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCMEPLQFMSLHIPEE
NRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMP
GLLRTGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDEKKKHGLPGIGLST
SLRPRMQFSSPSFVSINTEGYQYSPEFPLDILKAKTIQMLTEAVKEGSLHARDPVGGTTE
FLFVPLIKLFYTLLIMGVFHNEDLKHVLQLIEPSVFKEAASPEEESEVAEKEPFVEDSKL
EGAAEEENKGAKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAK
LQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDDKSECPCPEEIRDQ
LLDFHEDLMTHCGIELDEDRSLDGNNDLTIRGRLLSLVEKVTYLKKKQAEKPVESDSKKS
STLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVED
TINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVM
VNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMR
GSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEG
ERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAMEEAIKIAE
DPSRDGPSPTTGSSKTPDTEEEEDDTIHMGNAIMTFYSALIDLLGRCAPEMHLIHAAKGE
AIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNVVEPDMSAGFCPDHKAAMVLFLDRV
YGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLF
AGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFD
VPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQK
KYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQPVDTSNITIPE
KLEYFINKYAEHAHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPI
KESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSR
DLHAMAEMMAENYHNIWAKKKKLELEAKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKF
LQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGGSRSKGEHFP
YEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLV
RHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKSALRAFLDNAAEDLEKTMENL
KQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILT
SLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNIYSIYNTKSSRERAAL
NLPANVEDVCPNIPSLEKLMEEIVDLAESGIRYTQMPHVMEVVLPMLCSYMSRWWEHGPE
NNPGRAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLL
KTHFLPLMEKLKKKAAMVVSEEDHLKSEARGDMSEAELLILDEFTTLARDLYAFYPLLIR
FVDYNRAKWLKEPNQEAEDLFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLIMDT
KSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNR
FSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTEDTSDPEKTVERVLDIA
NVLFHLEQVSFCVDSVTFGLVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHR
AVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEEDEGTKRVDPLHQLILLFSRTA
LTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEVTGSQRSKEKEMEKQKLLYQ
QARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDV
GFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLC
EGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFS
KAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIEL
LKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLT
SSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRF
HEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIER
VYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQIS
ESDLNERSANKEESEKEKPEEQGPRMGFFSIMTVKSALFALRYNILTLMRMLSLKSLKKQ
MKKVKKMTVKDMITAFFTSYWSILMSLLHFVASVFRGFSRIIGSLLLGGSLVEGAKKIKV
AELLANMPDPTQDEVRGDGEEGERKTLEGALPSEDLTDLKELSEESDLLSDIFGLDLKRE
GGQYKLIPHNPNAGLSDLMSNPVPIPEVQEKFQEQKAKEEEKEEKEESKSEPEKAEGEDG
EKEEKAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNMRMLAL
FVAFAINFILLFYKVSTSSVVEGKELPTRSSSENARVSSLDSSSPRIIAVHYVLEESSGY
MEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIK
GQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKK
PKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSILGHYNNFFFAAHLLDIA
MGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCD
DMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLII
DAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLIN
KDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences E1BE29
ENSBTAP00000053650 ENSBTAP00000020240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]