SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053668 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053668
Domain Number 1 Region: 118-310
Classification Level Classification E-value
Superfamily L domain-like 3.12e-45
Family L domain 0.00000197
Further Details:      
 
Domain Number 2 Region: 508-667
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.9e-39
Family Protein kinases, catalytic subunit 0.000000834
Further Details:      
 
Domain Number 3 Region: 295-426
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.24e-22
Family Growth factor receptor domain 0.00000284
Further Details:      
 
Domain Number 4 Region: 8-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.69e-16
Family Growth factor receptor domain 0.00000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053668   Gene: ENSBTAG00000012647   Transcript: ENSBTAT00000061483
Sequence length 1110
Comment pep:novel chromosome:UMD3.1:2:99660620:99997642:-1 gene:ENSBTAG00000012647 transcript:ENSBTAT00000061483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFV
YNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCT
DICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPE
KLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQF
QSLKEISAGNIYITDNSNLCYYHTINWTTLFSTANQRIVIRDNRKAENCTAEGMVCNHLC
SNDGCWGPGPDQCLSCRRFSRGRTCIESCNLYDGEFREFENGSICVECDPQCEKMEDGIL
TCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADQDRECHPCHPNCTQGCSG
PTSHDCIYYLWTGHSTLPQHARTPLIAAGVIGGLFILVIVGLTFAVYARRKSIKKKRALR
RFLETELVEPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIP
VAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDY
VHEHKDNIGSQLLLNWCVQIAKSLIYLEKKRLVHRNINLKNILVKFPTYEKVNSFYLARV
VVGLQKEMKVSVEKQPVVLVLLFCINYNMFSHQHKLIWNHLQPDTEKMNYYGKEYSSQAT
TKIPSCLREEEAVVHPPAPRIDINMILAKLWAIFKDVAPSFKELMVKTNRMLLVPQGYLI
YKAKENRSLSSLGENVFLSNLKNDAFTIEDGLAQIMNIDNKYIMVSPASNIIPMLLSSPL
RIEDSVKSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVPMPYRATTSTIPEAPIAQGAT
AEIFDDSCCNGTLRKSMAPHVQEDSSTQRYSADPTVFAPERSPRGELDEEGYMTPMRDKP
KQEYLNPVEENPFVSRRKNGDLQALDNPEYHSASSGPPKAEDEYVNEPLYLNTFANALGN
AEYLKNSVLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRPIV
AENPEYLSEFSLKPGTVLPPPPYRHRNTVV
Download sequence
Identical sequences F1N758
ENSBTAP00000053668 ENSBTAP00000053668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]