SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053678 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053678
Domain Number 1 Region: 4823-5038
Classification Level Classification E-value
Superfamily GFP-like 7.53e-64
Family Domain G2 of nidogen-1 0.00068
Further Details:      
 
Domain Number 2 Region: 2424-2521
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-25
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 2532-2619
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-24
Family I set domains 0.0089
Further Details:      
 
Domain Number 4 Region: 2912-3011
Classification Level Classification E-value
Superfamily Immunoglobulin 2.08e-24
Family I set domains 0.0064
Further Details:      
 
Domain Number 5 Region: 3580-3672
Classification Level Classification E-value
Superfamily Immunoglobulin 3.05e-24
Family I set domains 0.0078
Further Details:      
 
Domain Number 6 Region: 3195-3295
Classification Level Classification E-value
Superfamily Immunoglobulin 3.35e-24
Family I set domains 0.0051
Further Details:      
 
Domain Number 7 Region: 1114-1211
Classification Level Classification E-value
Superfamily Immunoglobulin 7.83e-24
Family I set domains 0.012
Further Details:      
 
Domain Number 8 Region: 2341-2431
Classification Level Classification E-value
Superfamily Immunoglobulin 1.52e-23
Family I set domains 0.023
Further Details:      
 
Domain Number 9 Region: 4027-4124
Classification Level Classification E-value
Superfamily Immunoglobulin 4.8e-23
Family I set domains 0.033
Further Details:      
 
Domain Number 10 Region: 3019-3106
Classification Level Classification E-value
Superfamily Immunoglobulin 6.27e-23
Family I set domains 0.009
Further Details:      
 
Domain Number 11 Region: 1036-1127
Classification Level Classification E-value
Superfamily Immunoglobulin 9.28e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 12 Region: 553-647
Classification Level Classification E-value
Superfamily Immunoglobulin 9.45e-23
Family I set domains 0.017
Further Details:      
 
Domain Number 13 Region: 4117-4215
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 14 Region: 3848-3945
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 15 Region: 2832-2920
Classification Level Classification E-value
Superfamily Immunoglobulin 1.97e-22
Family I set domains 0.0071
Further Details:      
 
Domain Number 16 Region: 742-836
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-22
Family I set domains 0.014
Further Details:      
 
Domain Number 17 Region: 1771-1870
Classification Level Classification E-value
Superfamily Immunoglobulin 3.71e-22
Family I set domains 0.0085
Further Details:      
 
Domain Number 18 Region: 3939-4037
Classification Level Classification E-value
Superfamily Immunoglobulin 6.28e-22
Family I set domains 0.023
Further Details:      
 
Domain Number 19 Region: 1678-1778
Classification Level Classification E-value
Superfamily Immunoglobulin 6.67e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 20 Region: 4298-4393
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-21
Family I set domains 0.0081
Further Details:      
 
Domain Number 21 Region: 1397-1498
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-21
Family I set domains 0.023
Further Details:      
 
Domain Number 22 Region: 2248-2337
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-21
Family I set domains 0.019
Further Details:      
 
Domain Number 23 Region: 1879-1965
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-21
Family I set domains 0.033
Further Details:      
 
Domain Number 24 Region: 839-933
Classification Level Classification E-value
Superfamily Immunoglobulin 2.4e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 25 Region: 3661-3759
Classification Level Classification E-value
Superfamily Immunoglobulin 3.16e-21
Family I set domains 0.016
Further Details:      
 
Domain Number 26 Region: 3099-3199
Classification Level Classification E-value
Superfamily Immunoglobulin 3.22e-21
Family I set domains 0.0093
Further Details:      
 
Domain Number 27 Region: 467-567
Classification Level Classification E-value
Superfamily Immunoglobulin 3.35e-21
Family I set domains 0.025
Further Details:      
 
Domain Number 28 Region: 1316-1405
Classification Level Classification E-value
Superfamily Immunoglobulin 3.67e-21
Family I set domains 0.019
Further Details:      
 
Domain Number 29 Region: 2053-2147
Classification Level Classification E-value
Superfamily Immunoglobulin 4.83e-21
Family I set domains 0.0072
Further Details:      
 
Domain Number 30 Region: 3753-3852
Classification Level Classification E-value
Superfamily Immunoglobulin 5.17e-21
Family I set domains 0.0086
Further Details:      
 
Domain Number 31 Region: 2742-2824
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 32 Region: 3478-3575
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-20
Family I set domains 0.027
Further Details:      
 
Domain Number 33 Region: 3396-3482
Classification Level Classification E-value
Superfamily Immunoglobulin 2.08e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 34 Region: 3303-3388
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 35 Region: 2614-2721
Classification Level Classification E-value
Superfamily Immunoglobulin 3.07e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 36 Region: 4393-4485
Classification Level Classification E-value
Superfamily Immunoglobulin 3.46e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 37 Region: 1584-1685
Classification Level Classification E-value
Superfamily Immunoglobulin 4.69e-20
Family I set domains 0.0053
Further Details:      
 
Domain Number 38 Region: 4203-4301
Classification Level Classification E-value
Superfamily Immunoglobulin 5.02e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 39 Region: 1958-2056
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-19
Family I set domains 0.0059
Further Details:      
 
Domain Number 40 Region: 1506-1591
Classification Level Classification E-value
Superfamily Immunoglobulin 1.72e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 41 Region: 1227-1311
Classification Level Classification E-value
Superfamily Immunoglobulin 1.94e-19
Family I set domains 0.0035
Further Details:      
 
Domain Number 42 Region: 2141-2242
Classification Level Classification E-value
Superfamily Immunoglobulin 1.62e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 43 Region: 658-749
Classification Level Classification E-value
Superfamily Immunoglobulin 3.13e-18
Family I set domains 0.021
Further Details:      
 
Domain Number 44 Region: 931-1024
Classification Level Classification E-value
Superfamily Immunoglobulin 5.9e-17
Family I set domains 0.0088
Further Details:      
 
Domain Number 45 Region: 5044-5189
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.98e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 46 Region: 4535-4593
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 9.68e-16
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 47 Region: 1-166
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000119
Family Integrin A (or I) domain 0.03
Further Details:      
 
Domain Number 48 Region: 4592-4650
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000144
Family TSP-1 type 1 repeat 0.00017
Further Details:      
 
Domain Number 49 Region: 4480-4536
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000876
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 50 Region: 4650-4707
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000379
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 51 Region: 4764-4821
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000051
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 52 Region: 4707-4764
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000575
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 53 Region: 5153-5225,5252-5307
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000129
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 54 Region: 5364-5480
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 55 Region: 5223-5260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000172
Family EGF-type module 0.017
Further Details:      
 
Domain Number 56 Region: 396-470
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000596
Family C1 set domains (antibody constant domain-like) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053678   Gene: ENSBTAG00000015235   Transcript: ENSBTAT00000061144
Sequence length 5588
Comment pep:known chromosome:UMD3.1:16:68192901:68733392:1 gene:ENSBTAG00000015235 transcript:ENSBTAT00000061144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYDDLVQVIEGASKILETSLKRPKRPLFNFALVPFHDPEIGPVTVTTDPKKFQYELRELY
VQGGGDCPEMSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHEVLQLIQQKQSQVVFVL
TGDCDDRSHIGYRVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQASKVHLLSTDHLEQ
AENTWKIPFDPSLKEVTVSLSGPSPMIEIHNPLGKLIKKGFGLNELLNIHNSAKVVNVKE
PEAGIWTVKTSSTGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVSRPVQGIPTYVLLNTS
GISIPAKVDRLELLSISGSSLKTIPVKYYPDRKPYGIWNISDFIPPNEAFFLKVTGYDKD
GFLFQRVSSVSFSSIVPDAPKVTMPEKTPGYYLQPGQIPCAVDSLLPFTLSFVRNGATLG
VDQYLKESASVTWDIEEVTLADEGAYECVAVSTAGIGRAQTFFDVSEPPPVIQVPSNVTV
TPGETAVLTCLVVSAVGYNLTWQRNDRDIRLTDTAGMRILANLSLELRSVKFSDAGEYRC
VVSNEGGSSTEAVFLTVQEPPKVTVMPKNQSFTAGSEVSIMCSATGYPKPKIAWTMNDVF
IMGSHRYRMTSEGNLFIKNAVPKDAGIYGCLASNSAGMDKQTSTLRYIGNSPKLIVVQSE
LLVALGDTTVMECKTSGVPPPQVKWFKGDLELKPSTFLITDPLLGLLKIQETQDLDAGDY
TCVAVNDAGRATGRITLDVGSPPVFIQEPTDVSVEIGSNVTLPCYVQGYPEPKIKWRRVD
NMPIFSRPFSVSSISQLRTGDLFISNLWASDKGTYICEAENQFGKIQSQTTVTVTGLVAP
LIGISPPVTSVIEGQQLTLPCALLAGNPIPERRWIKNSAMLVQNPYITVRSDGSLHIERV
RLQDGGEYTCVASNVAGITNKTTTVDVHVLPTIQHGQQILSTIEGIPVTLPCKASGIPKP
SIAWSKKGELIFTSSAKFSAGADGSLYVVSPGGEESGEYVCTATNAAGYAKRKVQLTVYV
RPRVFGDQRGPSQDKPVEISVFAGEEVTLPCEVKGLPPPIITWAKETQLISPFSPRHTFL
PSGSMKITETRVSDSGMYLCVATNIAGNVTQSVKLNVHVPPKIQRGPKVMKVQVGQRVDI
PCSAQGTPLPVITWFKGGGAVLVDGLQHIRHPDGTLSIKQAVLSDAGIYTCVATNIAGSD
ETEITLHVQEPPILEDLEPPYNTPFQERVANQRIAFPCPAKGTPKPTIKWLRNGRELTGQ
EPGISILEDGTLLVIASVTPYDNGEYICVAVNEAGTTERRYNLKVHVPPVIKDKEQVTNV
SVLVNQPTSLFCEVEGTPSPIIMWYKDDVQVTESSSIQIVNNGKILKLFRTSPEDAGGYS
CKAVNVAGTSQKHFNIDVLVPPTIIGAGSPGEVSVVLNQNTTLECQVKGTPFPVIRWLKD
GKPLFLGDPNIEILDRGQVLHLKNARRSDKGRYQCSVSNAAGKQAKDIKLTIYIPPSIKG
GNVTTEVSALINSIIKLECETRGLPMPAITWYKDGQPVISSSQALYVEKGQFLHIPRAQV
SDSAAYKCLVTNVAGTAEKSFHVDVYVPPVIEGDLAEPLNKQVKVAHSLTLECKAAGNPP
PVLTWLKDGVPVKASDNIRIEAGGKKLEITSALEVDRGQYICVATSVAGEKEIKYEVDVL
VPPAIEGGDETSYFIVMVNNLLELDCQVTGSPLPTIMWLKDGQLIDERDGFRILLNGHKL
VIAQAQVSDTGLYRCVATNTAGDHRKEFEVTVHVPPTIKSSGLSERAVLKYKPITLQCIA
NGIPNPSITWLKDGQPVNTAQGNLKIQSSGRLLQIAKALMEDAGRYTCVATNAAGETQQH
IQLHVHEPPSLDDAGKMLNETVVVNSPVQLECKAAGTPSPAITWYKDNRPLSDSSSVTFL
NRGQIINIESAQITDAGIYKCVAINSAGATELFYSLQVHVPPSIFGSNNMVAVVVNNLVR
LECEARGIPAPSLTWLKDGSPVTSFVNGIQVLSGGRILALTSAQISDTGRYTCVAVNAAG
EKQRDIDLRVYVAPNIMGEEQNVSVLISQAVELLCQSDAIPPPTLTWLKDGHPLLKKPGL
SVTENGSVLKIEDAQVQDSGRYTCEATNVAGKTEKNYNVNIWVPPNISGSDEAAQLTVIE
GHLISLLCESSGIPPPNLIWKKKGSPVLADSAGRVRILSGGRQLQISVAEKSDAGLYSCM
ASNVAGTAKKDYSLQVYIRPTISNSGSHPTEIIVTRGKSVSLECEVEGVPQPAVTWMKDG
RPLTKGRGMEIMDEGRVVQLKNVHVSDTGRYVCVAMNIAGMTDRKYDLSVHTPPSIIGNH
RTPENISVVEKSSVSLNCEASGIPLPSITWLKDGWPVNLSSSLRILSGGRILRLMQTRTE
DAGQYTCVVRNAAGEERKIFRLSVLVPPHIMGENTFEDVKVKEKQSVTLTCEVTGNPVPE
ITWHKDGQLLKEDDTHHLMSGGRFLQIVNAQVSHTGRYTCLASNTAGDKSKSFSLNVLVS
PIIAGVDGDGSPEDVTVILNSPTSLVCEAYSYPPATITWFKNGTPLESNQNIRILPGGRT
LQILNAQEDDAGRYACVATNEAGEMIKHYEVKVYIPPIINKGDLLGPGLSPREVKIKVNN
TLTLECEAYAIPSASLSWYKDGQASQPLKSDDHVTIAAGGHTLQIKEAQISDTGRYTCVA
SNVAGEDELDFDVNIQVPPSFQKLWEIGNRVDTGRRGEAKDVIINNPISLYCETNAAPAP
TLTWYKDGHPLTSSERVLILPGGRVLQIPRAKVEDAGRYMCVAVNEAGEDSLQYDIRVLL
PPVIKGANGDLPEEVTVLVNKSVTMECSSSGSPTPRSSWQKDGQPLLEDERHTFLSNGRI
LQVLNSQITDIGRYVCVAENTAGSAKKYFNFNVHVPPSVIGPNPENLTVVVNNFISLTCE
VSGFPPPDLSWLKNEQPIKPNTNALIVPGGRTLQIIRAKVSDGGEYTCVAINQAGESKKK
VSLTVYVPPSIKDHGSESLSVVNVREGTSVSLECGSNAVPPPVITWYKNGRMLTESARLE
ILADGQMLHITKAEVSDTGQYVCRAINVAGRDDKNFHLNVYVPPSIEGPENEVTVETVSN
PVTLTCDATGIPPPSIAWLKNHRPIENSGSLEVHILSGGRKLQIARSQHSDSGNYTCIAS
NMEGKAQKHYILSIQVPPNVADAEIPSEVSVLLGENVELVCSANGIPTPLIQWLKDGKPI
VSSETERIRVAADGSTLNIYGALPSDMGKYTCVATNPAGEEDRIFNLNVYVPPAIRGNKE
EAEKLMALVDTSINIECRATGMPPPQINWLKNGLPLPLSSHIRLLSGGQVIRIVRAQASD
VAVYTCVASNRAGVDNKHFSLQVLVPPSLDNGMGTEEITIVKGSSTSMTCFTDGTPAPRM
SWLRDGRPLGLDAHLSISSQGMVLQLIKAETEDSGRYTCIASNEAGEVSKHFILKILEPP
HINGSEEPMEMSVIVNNPLELTCMASGIPAPKITWMKDGRPLPQMDQMQTLGGGEVLRIS
STQVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGTGEPQDFTVLRNRQVTLECKSDA
VPPPVITWLKNGERLQATPRIRILSGGRYLQINNADLGDTANYTCVASNIAGKTTREFIL
TVNVPPSIKSGPQSLVIHLNKSTLLECFAEGVPAPRITWRKDGAVLSGSHARYSVLENGF
LRIQSAQVTDGGRYLCMATSAAGTDRRRIDLQVHVPPSIAPGPTNISVTVNVQTTLACEA
TGIPKPSVNWRKNGHLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTNDAGEDKR
AVDLTVQVPPSIADEPTDFLVTKHTPTVITCTASGVPFPSIHWMKNGVRLLPRGEGYRIL
SSGAIEILDTQLSHAGRYTCVARNSAGSAHRHVSLHVQEPPVIQPQPSELDVILNNPILL
PCEATGTPSPFIIWQKEGISVISSGRSHAVLPRGGLQISRAVREDAGTYMCVAQNPAGTA
LGKIKLNVQVPPVISPHPKEYITVVDKPIMLPCKADGLPPPDIMWHKDGHVIVESVRQRI
LSSGALQIAFAQPGDAGQYTCMAANVAGSSSTSTKLTVHVPPRIQSTEVHYTVNENSQAV
LPCVADGIPTPAINWKKDNVPLANLLGKYTVEPYGELILENVVLEDSGTYTCIANNAAGE
DTHTISLTVHVLPTFTELPGDVSLNKGEQLRLNCKATGIPLPKLTWTFNNNIIPAHFDSV
NGHSELVIERISKEDSGTYVCTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWIEPLGGNA
ILNCEVKGDPAPTIQWSRRGIDIEISHRIRQLGNGSLAIYGTVNEDAGDYTCVATNEAGV
VERSMSLTLQSTPIITLEPVETIINAGSKVILNCQATGEPRPTITWSRQGHSILWDERIN
VLSNNSLHIAAAQKEDTSEYECVARNLMGSVLVRVPVIVQVPGGFSQWSAWRPCSATCGK
GIQKRSRLCNNPSPANGGKPCQGSDSEMQNCHQKPCPVDGNWSEWSPWEECTRSCGRGNR
TRTRTCNNPSAQHGGRPCEGTAMEIIMCNIRPCPVHGAWSTWQPWGTCSVSCGKGTQTRA
RLCNNPPPSFAGSYCDGAETQIQVCNERHCPIDGKWATWTSWSACSVSCGGGARQRTRDC
SDPAPQYGGNKCEGSDVQSDFCNSDSCPTHGNWSPWSGWGICSRTCNGGQMRRYRTCDNP
RPSNGGRACGGPDSQIQRCNTDMCPVDGSWGNWHSWSWCSTSCGGGEKTRERLCNNPIPS
KSGRPCPGDATQVSRCNIQVCPGGPQRARGSVIGSINDVEFGIAFLNATVTDSPNSDTRI
IHAKITNVPRSLGPAMRKIVSILNPIYWTTAKEIGEAVNGFTLTNAVFKRETQVEFATGE
ILRMTHVARGLDSDGALLVDIIVSGYVLQLQSPAEVTVKDYTEDYVQTGPGQLYAYSTRL
FTIDGVSVPYTWTHTVLYDEAQGRMPFLVETLHASSVESDYNQLEETLGFKIHASISKGE
RSNQCPPGFALDSVGPFCADENECAAGNPCSHSCHNAMGTYYCSCPKGLTIAADGRTCQD
IDECALGGYTCHAGQDCDNTIGSYRCVVHCGIGFRRTSDGLSCQDINECQESSPCHHRCF
NAIGSFHCGCEPGYQLKGRKCVDINECRQNVCRPDQHCKNTRGGYKCIDLCPNGMTKAEN
GTCIDVDECKDGTHQCRYNQICENTRGSYRCVCPRGYRSQGLGRPCLDINECEQVPKPCA
YQCFNTPGSFKCICPPGQHLLGDGKSCAGLERLPNYGNQYSSYNLARFSPMRNNYQPQQH
YRQYSHLYSSYSEYRNSRTSLSRTRRTIRKTCPEGSEASLDTCVDINECENTDTCQHECK
NTFGSYQCICPPGYQLMLNGKTCQDIDECLEQNVRCGPNRMCFNMRGSYRCIETPCPPDY
QRDPVSGFCLKNCPPNDLECALSPYALEYKLVSLPFGIAANQDLIRLVAYTQDGVMHPRT
TFLMIDEEQTVPFALRDENLKGVVYTIRPLQEPETYRMRVRALSYGANGTVEYQTTFIVY
IAVSAYPY
Download sequence
Identical sequences E1BE11
ENSBTAP00000053678 ENSBTAP00000053678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]