SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053681 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053681
Domain Number 1 Region: 487-643
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.96e-28
Family Growth factor receptor domain 0.00047
Further Details:      
 
Domain Number 2 Region: 628-796
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.68e-28
Family Growth factor receptor domain 0.00034
Further Details:      
 
Domain Number 3 Region: 881-1039
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.11e-27
Family Growth factor receptor domain 0.00075
Further Details:      
 
Domain Number 4 Region: 2540-2661
Classification Level Classification E-value
Superfamily CalX-like 4.19e-25
Family CalX-beta domain 0.00092
Further Details:      
 
Domain Number 5 Region: 2905-3027
Classification Level Classification E-value
Superfamily CalX-like 8.76e-24
Family CalX-beta domain 0.0018
Further Details:      
 
Domain Number 6 Region: 2786-2901
Classification Level Classification E-value
Superfamily CalX-like 1.57e-20
Family CalX-beta domain 0.0018
Further Details:      
 
Domain Number 7 Region: 2661-2786
Classification Level Classification E-value
Superfamily CalX-like 2.35e-19
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 8 Region: 399-503
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-18
Family Growth factor receptor domain 0.001
Further Details:      
 
Domain Number 9 Region: 788-905
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-17
Family Growth factor receptor domain 0.00092
Further Details:      
 
Domain Number 10 Region: 124-195
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000638
Family VWC domain 0.03
Further Details:      
 
Domain Number 11 Region: 198-258
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000377
Family VWC domain 0.029
Further Details:      
 
Domain Number 12 Region: 65-132
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000167
Family VWC domain 0.011
Further Details:      
 
Domain Number 13 Region: 255-322
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000105
Family VWC domain 0.012
Further Details:      
 
Domain Number 14 Region: 3026-3096
Classification Level Classification E-value
Superfamily CalX-like 0.0000000017
Family CalX-beta domain 0.0036
Further Details:      
 
Domain Number 15 Region: 14-67
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000439
Family VWC domain 0.0052
Further Details:      
 
Domain Number 16 Region: 346-400
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000513
Family VWC domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053681   Gene: ENSBTAG00000010716   Transcript: ENSBTAT00000060947
Sequence length 4001
Comment pep:known_by_projection chromosome:UMD3.1:6:94711652:95055569:1 gene:ENSBTAG00000010716 transcript:ENSBTAT00000060947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLHALVFEAYASLQDATIWKPDSCQNCRCHGDIVICKPAVCRNPQCAFEKGEVLQIPANQ
CCPECVPRMPGSCHYEKKIHGHGTAWASSPCSTCSCTHGEVRCAPQPCPPLMCGHQELEF
IPEGSCCPVCVGPGKSCSYEGRVFQDGEDWPLSRCAKCVCRNGVAQCFAAQCPPLFCNQD
ETVIRVPGKCCPQCSSLSCSAAGQVYEHGEQWQENACTTCTCDQGQVRCHKQPCPPLRCE
KGQRRARLPGQCCEDCVSPAGSCSHRGLVRYQDDMWKGSACEFCVCNRGQVTCQTAECAK
VECAQGEELIHLEGKCCPECISRNGYCVYEENAEFAGDAVCAGLKHVSEGEKWEDGPCKV
CECRGAQITCYEPSCPPCPVATLAQAVKGQCCPDCTSVRCHPDCLTCSQSPDHCDLCQDP
TKLLRNGQCVHSCGLGFYQAGALCLACQPQCSTCTSGLECSSCQPPLLMQQGQCVSTCGI
GFYQDRHSCAACHESCAACWGPTEKHCLACRDPLHVLREGGCESSCGNRFYNKQGTCSAC
DQSCKSCGPSSPRCLTCVEKTVLHDGKCISECPGGYYADATGRCKVCHNSCASCSGPTAA
HCTACIHPQALRQGHCLPNCGEAFYPDHGVCKACHTSCLTCVGPAHSHCTQCRKPEDGLQ
FEPLSGANITSGECLSRCRAQFYLEITGLCEACHPSCSACAGMSPHNCTACWPSHMLLDG
ECLSQCPDGYFNQEGSCTECHPTCRQCHGPLESDCISCHPHVPLTAGSCRARCKEEQFLN
LVGYCADCHPLCHHCAANLRDTGSVCLQCQNARNLLLGDRCVPDCPSGYFVERGACKKCH
SSCRTCQGRGPFSCSSCDTGRVLSHLGTCSIACFPGHYLDDNRVCQPCNMHCGRCDSQAS
CTSCRDPSKVLLFGDCQHESCAPQYYLDFSTKTCKECDWSCNVCSGPLRTDCLQCMDGYV
LQDGACVEQCSASFYRDLGLCKSCESHCLQCQGPHECTRCEEPFLLLEAQCVQECGKGFF
ADHANHKCTACPKGCLQCSRRDRCHLCDQGFFLKSGLCLSNCVPGFSAHSSNETCAGKIH
TPSLHVNGSLTLAIGSMKPLDFFLLNVQDQGGRVEDLLFHVVSAPTNGQLVLSRNGKEAQ
LDKAGHFSWRDVKEKKVRFVHSREKPRKGYFSLKISDQQFFSEPQLINIQAFSTQAPYVL
RNEVLHINRGERGTITTQLLDIRDDDNPQDVVVEVLDPPLHGQLLQTLQSPAAPIYQFRL
DELSRGLVQYVHDGSDSTSDITVLQANDGHSFQNILFHEALEENDRGLRLVANSMVWVPE
GGMLQITNRILQAEAPGASASEIIYKITQDHPQFGEVVLLVNMPADSPADGGQHLPDGRT
ATPTSTFTQQDINEGIVWYRHSGVPAQSDSFRFQVSSATEAHTHLESRLFNIAILPHALE
TPQHFPGSLHMTAREDGLTVIQPHSLSFVNSERPNRKLIYNITLPLHPNQGIIEHRDQPH
SPIRYFSQEDVNQGNIMYRPPTAAPHLQEIRAFSFAGLPESVKFHFTVSDGEHTSPEMAL
TIHLLRTDQYPPLFQVTAPLLVVSPGGSTSIELQLVVRDMETVPEELLFELRKPPQHGVL
IKYTAGSPGPMATGDTFTYEDVEKNVLRYLHDGSSAREDSMEISVTDGLSATTVDVRVEV
SPAEAQGPRLAAGASLSVTVASKSTAVITRSHLAYVDDSSSDPEIWIQITSLPMYGALLK
TAGPEVEELSEISNFTMEDINNKKIRYSAAFETGGHPVTDSFHFSVSDMDHNRLDNQKFT
ITITPVKDPPPVIAFADLITVDEGGRTPLSFHHFFAAAAEDNFQEDAIIKLSALPQYGCI
ENTGTGDRFGPGTTSDLEASFPIQDVLENYIYYFQSVHESIEPTHDIFSFYVSDGNSRSE
VHSINITIEHRKNDEPPRMTLRPLGVQLSSGVVISNSSLSLQDLDTPDNELIFVLTKKPG
HGHLLWRQTASEPLENGRVLAQGSSFTYQDILAGLVGYMPGGPGVAVDEFQFSLTDGLHT
DTGRMEIYIELPTSDIPNLAVNRGLQVSAGSVATITDRHLKVTAPDSDDHQVMYILKEDP
GVGRLQMVKRDSLEQISTRGPIQSFTQADISQGLIEYSHGKGESGGNFAFKFDVVDGEGN
KLIGQSFSISVSEDKSPPVIITNKGLFLDENSVKKITTLQLSATDQEAEPTELVYRIIRE
PQLGRLEHTASPGIQISSFTQADLTSGNVQYIHSSETEKHSDAFSFTLSDGVHEVSEKLA
SLLDGYQFSVLSFNWIEFSLPLNQQPVRRSFSVGQGVSRMALGISLPFQCAHCISTWQVI
TFIFPLPYCGCFPSSFDFQKRKKKKDFRMNQQEGHLSDKHKSTNAFILDFFCPFSPCEQF
FLKKRKKIITAAPQQFWIDILPVDDGTPRIVTNLGLQWLEYMDGQATNLITKKELLTMDP
DTEDLQLVYEITTGPKHGHVENKLQPGRAVATFTQEDVNLGLIRYVLHEEKIHEMMDSFQ
FLVKDSKPNVVNDNIFHIQWSLISFKYTSYNVSEKAGSVSVTVQRTGNLNQYAIVLCRTE
QGTATSSSRVGSQPGQQDYVEYAGQVQFDEREDTKSCTIVINDDNVFEDVESFTVELSMP
AYALLGEFTQAKVIINDTEDEPTLEFDKKTYRVNESAGFLFAPIERKGDSSSIVSVICYT
VPKSAMGSSLYALESGSDFKSRGMSAESRVIFGPGVTMSTCDVMLIDDSEYEEEEEFEIA
LTGASDNARIGRMASAKVLIAGPNDASTVSLGNTAFTISEDAGTVKIPVIRHGTDLSTFT
SVWCATRPSDPASATPGVDYVPSSRKVEFGPGVTEQYCTLTILDDTQYPVIEGLETFVVF
LSSPQGAELTKPFQAVIAINDTFQDVPSMQFAKDLLLVKEKEGVLHVPIIRSGDLSYESS
VRCYTQGLSAQVMEDFEERRNADSSRITFLKGEKMKNCTVYIHDDSMFEPEEQFRVYLGR
PLGNHWSGARVGKNHMATITISNDEDAPTIEFEEAAYQVREPSGPDATAILNVKVIRRGD
QNRTSKIRCSTRDGSAQSGVDYYPKSRVLKFSPEVLLKREANILYLKEKRWHGKKSSVLG
PAPPIVSLMTQRMVASVLGIREVAKGNLTYVAPWQVVTLADYDHVEEVTKEGVKKSPSPG
YPLICVTPCDPHFPKYAVMKERCIEAGINQTSVQFSWEVAAPTDGNGARSPFETITDNTP
FTSVNHMVLDSIYFSRRFHVRCVAKAVDKVGHVGTPLRSNVVTIGTDSAICHTPVVAGTA
RGFQAQSFIATLKYLDVKHKEHPNRIHISVQIPHQDGMLPLISTMPLHNLHFLLSESIYR
HQHVCSNLVTTRDLRGISEAGFLDDRVHDSMALGPGYDRPFQFDSSVREPKTIQLYKHLN
LKSCVWTFDAYYDMTELIDVCGGSVTADFQVRDSAQSFLTVHVPLHVSYIYVTAPRGWAS
LEHHTEMEFSFFYDTVLWRTGIQTDSVLSARLQIIRIYIREDGRLVIEFKTHAKFREIGQ
FVMEHHTLPDVKSFILTPDHLGGIEFDLQLLWSAQTFDSPYQLWRATSSYNRKDYSGEYT
IYLIPCTVQPTQPWADPGEKPLACTAHAPERFLIPIAFQQTNRPVPVVYSLNTEFQLCNN
EKVFLMDPNTSDMSLAEMDYKGAFSKGQILYGRVLWNPEQNLNSAYKLQLEKVYLCTGKD
GYVPFFDPTGTIYNEGPQYGCIQPNKHLKHRFLLLDRSQPEVTDKYFHDVPFEAHFASEL
PDFHVVSSMPGVDGFTLKVDALYKVEAGHQWYLQVIYIIGPDTISGPRVQRSLTAPLRRH
RRDLADPSGWLSLDESLIYDNEGDQVKNGTNMKSLNLEMQEPVIAASLSQTGASIGSALA
AIMLLLLVSLVACFITRKCQKQRKKPPTGDILEEYPLNTKVDMPKRGVDRVEKNVDRQYC
TVRNVNILGEAERAYVFRGAKVKKLNLEVRVHNNLQDGTEV
Download sequence
Identical sequences F1N740
ENSBTAP00000053681 ENSBTAP00000053681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]