SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053720 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053720
Domain Number 1 Region: 3-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6e-35
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 178-363
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-28
Family Laminin G-like module 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053720   Gene: ENSBTAG00000027832   Transcript: ENSBTAT00000061048
Sequence length 364
Comment pep:novel chromosome:UMD3.1:4:112258912:112535083:1 gene:ENSBTAG00000027832 transcript:ENSBTAT00000061048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYWNAASFPNPSSYLHFSTFQGETSADISFYFKTLIPRGVFLENLGNTDFIKLELKSATE
VSFSFDVGNGPVEMVVRSPTPLNDDQWHRVTAERNVKQASLQVDRLPQQVRKAPTEGHTR
LELYSQLFVGGAGGQQGFLGCIRSLRMNGVTLDLEERAKVTSGFKSGCSGHCTSYGANCE
NGGKCIEKYHGYSCDCSNTAYDGTFCNKADVGAFFEEGMWLRYNFQAPGIGTRDSGSRSE
NSPDPQNGAPDLAGEEIRFSFSTTKAPCILLYVSSFTTDFLAALVKPTGSLQVRYNLGGT
REPYNIDVDHRSMANGQPHSVNITRRERTITLKLDHYPSVSYHLPSSSDTLFNSPKSLFL
GKVI
Download sequence
Identical sequences F1MDE4
ENSBTAP00000053720 ENSBTAP00000053720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]