SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053724 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053724
Domain Number 1 Region: 1-194
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.36e-44
Family L-arabinose binding protein-like 0.0000000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053724   Gene: ENSBTAG00000044181   Transcript: ENSBTAT00000061121
Sequence length 896
Comment pep:known_by_projection chromosome:UMD3.1:9:84704655:84817694:1 gene:ENSBTAG00000044181 transcript:ENSBTAT00000061121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRF
QCRLPGHILENPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHQALCPGHV
GLCDAMKPIDGSKLLEFLIKSTFIGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVH
VGTWHEGVLNIDDYKIQMNKSGVVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEYV
QDEFTCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIVFSCLGILVTMFVTLIFVL
YRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALV
TKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVITLIIMEPPMPILSY
PSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCI
IWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVV
RMHVGDGKLPCRSNTLLSIFRRKKPGAGNAKLLVEERRVLCIKSQTQCSNKESILKMSGK
QTELSSNGKSVSWSEPGGRQVPKGQHMWHRLSVHVKANETACNQTAVIKPLTKSYQGSGK
SLTFSDTSTKTLYNVEEEDAQPVGFSPPSSPSRAAPRRVPTAASTPPLPPHLTAEETPLF
LAEPAIPKGLPAPLQQPPLPQKSFLDQLQGVVNNFSAGIPDFSSVLAVPGAAGNGGRSLF
PPPAPPQHLPLLPLPLSPFAEEPASPPGEEYLSEREGNTEEDELEEEEEEGDLPAPSKPT
PEASPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVTYASVILRDYKQSSSTL
Download sequence
Identical sequences F1MDE0
ENSBTAP00000053724 ENSBTAP00000053724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]