SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053737 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053737
Domain Number 1 Region: 209-347
Classification Level Classification E-value
Superfamily C-type lectin-like 9.8e-32
Family C-type lectin domain 0.00096
Further Details:      
 
Domain Number 2 Region: 365-516
Classification Level Classification E-value
Superfamily C-type lectin-like 1.33e-30
Family C-type lectin domain 0.00066
Further Details:      
 
Domain Number 3 Region: 946-1094
Classification Level Classification E-value
Superfamily C-type lectin-like 1.47e-28
Family C-type lectin domain 0.0045
Further Details:      
 
Domain Number 4 Region: 1373-1516
Classification Level Classification E-value
Superfamily C-type lectin-like 1.5e-28
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 5 Region: 1107-1224
Classification Level Classification E-value
Superfamily C-type lectin-like 9.11e-28
Family C-type lectin domain 0.0009
Further Details:      
 
Domain Number 6 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.09e-26
Family Cysteine rich domain 0.0053
Further Details:      
 
Domain Number 7 Region: 1538-1664
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-26
Family C-type lectin domain 0.0007
Further Details:      
 
Domain Number 8 Region: 636-793
Classification Level Classification E-value
Superfamily C-type lectin-like 1.58e-24
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 9 Region: 499-626
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-19
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 10 Region: 1236-1360
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-18
Family C-type lectin domain 0.0042
Further Details:      
 
Domain Number 11 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 5.71e-16
Family Fibronectin type II module 0.002
Further Details:      
 
Domain Number 12 Region: 801-933
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000000015
Family C-type lectin domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053737   Gene: ENSBTAG00000017797   Transcript: ENSBTAT00000061220
Sequence length 1723
Comment pep:known chromosome:UMD3.1:2:36557431:36648018:1 gene:ENSBTAG00000017797 transcript:ENSBTAT00000061220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTRWATPRRAAELLMLLLPGFGLVEPSGHSGNDPFTIVNENTGKCITPLNDWIVVKDCD
ETKDMLWKWVSQHRLFHLQSQKCLGLDITKPTDSLRMFSCDSNAMLWWKCEHHSLYGAAQ
YQLALRDGHAIASTNSSDVWKKGGSEENLCAQPYHEIYTRDGNSFGRPCEFPFLVNGTWH
HECIFDGDRSGPWCATTLNYEYDQQWGICLQPESGCEDNWEKNEEIGSCYQFNIQATLSW
KEAYVSCQNQGADLLSINSAAELTYLKGKEGIARIFWIGLNQLYSARGWEWSDHRPLNFL
NWDPDVLMTPIIGRSSCARMDADSGLWQSFSCEAQLPYVCEKLLNSTVELTDMWTYSDTH
CDAADWVPNDGFCYLLVNESDSWDKAHTTCQTFSSDLISIHSLADVEVVVTKLHNGDAEG
EMWTGLRNINTPALFQWSDGTEVTLTYWDENEPRVPYNETPNCVSYSGKLGQWKVQSCEE
KLKYVCKKKGEKLNDTRSDKICPPEEGWKRHGETCYKIYKDEVPFGTNCNLTITSRFEQE
YLNDMIKKHTMSPEKYFWTGLRDTDANGEYSWASVGGVKRAVTFSNWNFFEPASPGGCVV
MATGKSLGKWEVKDCRSFRALSICKKMSQHSEPEKAAPKPEDPCPEGWHSSPSGLSCYKL
FHRERIVRKRNWEEAERFCQALGGHLPSFSHMDEIKEFLHFLIEQFSDQRWLWIGLNKRS
PDLQGSWQWSDHTPVSTIITANEFQQDYDIRDCAAVKVMQRPWRRSWYFYDDREYMNLRP
FACDAKLEWVCQIPKGHTLKIPDWYNPERAGIHGPPVVVEGSEYWFVADPRLSYEEAVLY
CDSNHSSLASLTSFTGLRAIKNKIANISSDEQKWWVRTTEQLKSHRFIYSRDPWHHFPIM
FGEECFYLSAKTWFNDLRKPADCSTNLPFVCEKHNVSSLEKYSPDSAAKVQCSGDWITFQ
NKCFLRINPKSVTFSEASDICHTYGGTLPSVLSQREQDFITSLFPDMEASLWIGLRWTAY
EKIKKWMDNRELTYSNFHPLLVGRRLRIPPNIFDEEASYHCAVMLNLQKSPFTGMWNFTS
CSEHHTLSLCQKYSEIESRQTLWNTTETMKYQNNLYKIILKTLTWTDALRECQKENMRLV
SITDPYQQAFLTVQAVVRNSSLWIGLSSHDDELNFGWSDGKHLQFSRWAENNEQLEDCVV
LDTDGFWKTSDCDNNQPGAICYYSGNETKKEVKPVASFQCPSPVLSTPWIPFQNSCYNFL
ITENRYRVPTQDEVHSKCKTLNPKSHILSIRDEKENNFVLEQLLHYNYMASWVILGITYE
NNSLRWSDKTTLSYTHWRSGRPAIKDGKFIAGLSTDGFWDIQTFNVVGDLLYFHQHSILA
CKIEMVDYKEEYNTTLPQFIPYEDGIYNVIQKKVTWYGALNACSQSGGHLASVHDQNGQL
FLEDIVKRDGFPLWVGLSSHDGSESSFEWSDGSAFDYIPWKDKKSAGNCVVLDPKGIWKH
ENCKSVKDGAICYKPTESKEVSSYTYSSRCPGVKGNKSQWVQYRDHCYTSDQALHSFSEA
RQFCSKLAHSATVVTIKDEDENKFVSRLMRENNNITMRVWLGLSQLSADHSWNWLDGSKV
TFVKWANKIKSGSGQCSILLASNETWTKVECSRGYGRVVCKVPLGPDYRGIGIAFAVLSI
LAVTCGLIWLFFRRNRWHWLGFSSVRYQQGGNEDEIMLPSFHD
Download sequence
Identical sequences E1BC77
ENSBTAP00000053737 ENSBTAP00000053737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]