SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053776 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053776
Domain Number 1 Region: 1705-2008
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000301
Further Details:      
 
Domain Number 2 Region: 37-300
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.28e-75
Family Carbonic anhydrase 0.00000739
Further Details:      
 
Domain Number 3 Region: 2024-2294
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.06e-71
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000174
Further Details:      
 
Domain Number 4 Region: 309-409
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000139
Family Fibronectin type III 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053776   Gene: ENSBTAG00000012119   Transcript: ENSBTAT00000061644
Sequence length 2324
Comment pep:known_by_projection chromosome:UMD3.1:4:87077523:87295626:1 gene:ENSBTAG00000012119 transcript:ENSBTAT00000061644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLILKRFLACIQLLCVCRLDWIYGYYRQQRKLVEEIGWSYTGALNQKNWGKKYPTCNSPK
QSPINIDEDLTQVNVNLKKLKFQDWDKTSLENTFIHNTGKTVEINLTNDYRLSGGVSETV
FKASKIAFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAIKGKGKLRALS
ILFEVGIEENLDYKAIIDGVERVSRFGKQAALDPFTLLNLLPNSTDKYYTYNGSLTSPPC
TDTVDWIIFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
TGKEEIHEAVCSSEPENVQADPENYTSLLVTWERPRVVYDTMIEKFAVLYQQLEGEDQTK
HEFLTDGYQDLGAILNNLLPNMSYVLQIVAICTNGLYGKYSDQLIVDMPSDDPELDLFPE
LIGTEEIIKEEEEGKDMEGDTAVNPGRDGATNQIRRKEPQIPTTTNYNRVGTKYNEAKTN
RSPARGSEFSGKSGIPNISLDSTSQPVTELDPEKDVPSTSQTVTQPPPLTLAGTSASSSD
DSQTILRFPQMNLSGTVEYSDTVSTTESQEVSTDISEEESLLTSFKLDPGADDSSGSSPA
TSAVPFVSENTPHGGVFPSENPEVVTYDVFIPESARNASEDSASSGSEESLKDPSVDGNV
WFPSTTDVTTLPDVGSGRESLLQTNYTDVDSDESEKTTESSPPGPLLSQGPSVSDVRMPQ
YSTFAYFPTEVTPHAFTPSSGQHHSVPTVNVVHAQTTQPVYNGEAPLQPSYSSEVFPLVT
PLLLDNQTLNTTPAASSSDRALHATPVFPSVGVSVESILSSYDGAPLLPFSSASSSSELL
HRVYTISQILPQVTAALESDQGSLHVSLPVAGGDLLLEPSLAPYSDAVSHQITTRAASET
LEFGASKPAVLYQTLVFSPAEASSSDVMMHARSSGPEPSYALTNEEGSQHLFRVSDSSAV
PGRDSVQGSLSSSPSHHLPMPESPLVTPSALLLQPTQGLSGDGEWSGASSDSEFFVPDTD
GLTALNISSPVSVAEFTYPTSMSGDDNKLLSKSDRIHGEETERHISSFSDLVYPSESTVM
PDPYDRVNTLNASLQESSASTSSPEGILPELLAFTATKVYDHEISQIPENNFPVQSSHAV
SQAFGDTSLKPALSAHSEPASSDPTSSEMLSPSTQLLVYEPSASFSTEVLLQPSFQASGV
DLLLKTALPAVPSDPIVVETPKVDHISSTVPHLMASSAASRENTLHSPSVPISDVSSTPN
THVASLQVLTISYASEKYSEPLLHKSESSHQTVPSLYSNDELFQTANLELNQAFPPEGRH
AFATPVLSVAPPDTLINKLVYSDEVFTSTKGPVTDEVLAGIPTVVSDPVVTADPSVPLGN
VYVSISAISPNKNGSVTTTKLLFPSRTTSEPIQSARSDANLVGGGDNGDIDDYGDDDYDD
RDKDGLSINRCMSCFSYRESQEKVMNDSDTQQNSSVDQNNPISYALSQNSEEGNRITGVI
SDDQTDMDRSPDKSPPTNVPPQKHNDGKQENDVQTHNTLLPFSPESNAWAVLTSDEESGS
GQGASDSLNDNETSTDFSFPDINEKDGDGVLETGDSEITPGSPQSSTPTITSGHSEVFNI
SEAEASNSSHESRIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAHF
YLEDSTSPRVISTPPTPIFPISDDVGAIPIKHFPKHVADLHASSGFTEEFETLKEFYQEV
QSCTVDLGITADSSNHPDNKHKNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGY
NRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPVDGSEEYGN
FLVTQKSIQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYSLPV
LTFVRKASHAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNVFGFLKHIRSQ
RNYLVQTEEQYVFIHDALVEAILSKETEVPDSHIHAYVNGLLIPGPTGKTKLEKQFKLLS
QSNIQQSDYSTALKQCNREKNRTSSIIPVERSRVGISSLSGEGADYINASYIMGYYQSNE
FIITQHPLLHTIQDFWRMIWDHNAQLVVMLPDGQNMAEDEFVYWPNKDEPINCESFKVTL
MAEEHKCLSNEEKLIMQDFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISIIKEE
AATRDGPMIVHDEHGGVTAGTFCALTTLMHQLEKENSMDVYQVAKMINLMRPGVFADIEQ
YQFLYKAVLSLVSTRQEENPSTSLDSNGAALADGNIAESLESLV
Download sequence
Identical sequences F1MGK5
ENSBTAP00000053776 NP_001179201.1.59421 NP_001179201.1.76553 ENSBTAP00000053776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]