SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053786 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053786
Domain Number 1 Region: 29-165
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-23
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 2 Region: 234-352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000377
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053786   Gene: ENSBTAG00000044073   Transcript: ENSBTAT00000061487
Sequence length 761
Comment pep:known_by_projection chromosome:UMD3.1:29:45016284:45018614:-1 gene:ENSBTAG00000044073 transcript:ENSBTAT00000061487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRLLLAWAAAVPTLGQAPWATEPRAACAPGSCYALFPRRRTFLEAWRACRELGGDLAT
PRTLEEAQRVDSLVGSGPASRLLWIGLQRQARQCQPQRPLRGFTWTTGDQDTAFTNWAQP
ATGGPCPAQRCAALEASGEHRWLEGSCTLAVDGYLCQFGFEGSCPALPEEVGQAGPAVYT
TPFHLVSEEFEWLPFGSVAAVPCQAGRKASLLCVKQPEGGVGWSRTGPLCPGIGCGPDNG
GCEHECIEAADGRVSCRCSEGFRLAADGRSCEDPCAHAPCEQQCEPGGPQGYSCHCRLGF
RPAEDEPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISCSPAGAMGAQA
SQDLEDGLLDEGEEEEEEEDEEEAWEAFDGGWTEMPGIPWMEATQSSDFDLVYRPSFPED
GEPGMPYLYPTWPPPLSAPEVPHHSSVLSVTRPVVASATRPPLPSAHQPPPVIPAIHPAL
PSDHQFPMISANYPDLPSAHRPLIISAAQPGPTPAHQPPVASAKYPKLFPAHQSPMFPDT
QVVDTQNTTPLPRIPANHTPLVTTSSPPQPPVTRDVPILKAQAGHHPVTSPVQPSRTTAF
RSPVPPAHQVPVPAASQAPASHTPLPPRSSTSQTSLTSAPHPRSKVPQAPREGALGPSLA
PWPSSAVPTSAPPALGEASPAGRSRRDERWLLVALLVPTCVFLVVLLALGIVYCTRCGPH
APNKRVTDCYRWVTHAGSKGPTEPAPHRGSLTGVQTCRTSV
Download sequence
Identical sequences E1BC38
ENSBTAP00000053786 ENSBTAP00000053786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]