SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053802 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053802
Domain Number 1 Region: 2126-2426
Classification Level Classification E-value
Superfamily BEACH domain 4.05e-128
Family BEACH domain 0.0000000000124
Further Details:      
 
Domain Number 2 Region: 2543-2796
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.16e-30
Family WD40-repeat 0.0063
Further Details:      
 
Domain Number 3 Region: 2014-2121
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-30
Family PreBEACH PH-like domain 0.00000224
Further Details:      
 
Domain Number 4 Region: 112-303
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.64e-20
Family Clostridium neurotoxins, the second last domain 0.053
Further Details:      
 
Domain Number 5 Region: 395-502,539-836
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000000475
Family Plakophilin 1 helical region 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053802   Gene: ENSBTAG00000022991   Transcript: ENSBTAT00000061623
Sequence length 2809
Comment pep:known_by_projection chromosome:UMD3.1:12:25792986:26361421:-1 gene:ENSBTAG00000022991 transcript:ENSBTAT00000061623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILSLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTS
TEVGLIEQVLLKMSAVDDMIADLLVDMLGVLASYSITVKELKLLFSMLRGESGIWPRHAV
KLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVD
KDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKFFQISIIHYF
GRCRRSQIFQYLYGRLIGYMDLCWQSNNNRSYDKCFLNYNDTYDTDRVICGRIGAVYIFS
RKLTPYQFISVQELNPLFKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAKATDA
QLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQL
NDSQVETTVCATLLAFLVELLKSSVAMQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQF
LSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKSLDSDLQPFEERKSDGPRPSQKE
IISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIHDVLQLLVALMSEHPAS
MIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGE
RLMLHTNTVTVTTYNTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNST
PSAELMEVRRLFLSDMIKLFSNSRENRRRCLLQCSVWQDWMFSLGYINPKNSEEQKITEM
VYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKK
GKKGNVSTISGLSSQTTGAKGGMEIREIEDLSQSQSPESETDYPVSTDTRDLLMSTKVPD
DILGNSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPETLVGGENGALVEVESL
LDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLADEKDELPNSSTSFLFDKIPKQE
EKLLPELSSNHIIPHIQDTQVHLGDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGM
SSISDRDLASSSKGLEYAEMTATTLETESSGSKIVPNVDAGSIISDTERSDDGKESGKEI
RKIQTTTTTQAVQGRSITQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWS
PMHQRLLTDLLFALETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIAC
GGILPLLSAATSPTGSKTELENIEVTQGMSAETAVTFLSRLMAMVDVLVFASSLNFSEIE
AEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGNKSSHGSSKPQEAPQGVTATAAS
KTPLENVPGNLSPIKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVS
KYRDILEPQRETARTGSQPGRNIRQEINSPTSTVVVIPSIPHPSLNHGFLAKLIPEQSFA
HSFYKETPAAFPDTVKEKEAPTPGEDIHLESSIPHTDSGIGEEQVANILNGAELETSTGP
DAMSELLSTLSNEVKKSQESLTENPSEILKSAPSISSISQTKGINVKEILKSLVAAPVEI
AECGPEPVPYPDPALKREAQAILPMQFHSFDRSVVVPVKKPPPGSLAVTTVGATAAGSGL
PTGSTSNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPED
SAENMSITAKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGLVCMKSSTSVV
ELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHIVRVANEAEFILNRQRAEDV
HKHAEFESQCAQYAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAV
SHSQLHDFWRLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIEYGTEEDVVKSKKTFRSQ
AIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLSTPAQLIAPVVVAKGTLSITTTE
IYFEVDEDDPAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSV
MFNFPDQATVKKVVYSLPRVGVGTSYGLPQARRISLATPRQLYKSSNMTQRWQRREISNF
EYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEELDLTLPGNFRDLSKPIGALNPKRAVF
YAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNANDGKFDHPNRTFSSV
ARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDF
VRINRMALESEFVSCQLHQWIDLVFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVL
REAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNS
PVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLI
ANNSGVNKRQITDLVDQSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVF
GHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDYPAPRAVLT
GHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHC
IIYYERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQL
YIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQNRY
Download sequence
Identical sequences F1MF64
ENSBTAP00000053802 ENSBTAP00000053802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]