SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053830 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053830
Domain Number 1 Region: 345-473
Classification Level Classification E-value
Superfamily TIMP-like 2.04e-29
Family Tissue inhibitor of metalloproteinases, TIMP 0.029
Further Details:      
 
Domain Number 2 Region: 212-265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 3 Region: 157-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000628
Family Laminin-type module 0.086
Further Details:      
 
Domain Number 4 Region: 275-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family Laminin-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053830   Gene: ENSBTAG00000044132   Transcript: ENSBTAT00000061223
Sequence length 489
Comment pep:known_by_projection chromosome:UMD3.1:18:55745678:55751080:-1 gene:ENSBTAG00000044132 transcript:ENSBTAT00000061223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTFALWLLLSQASADPCYHPGGRPRFCLPPVTQLAGMAASCPQACGPSPGVDLGPRAP
CNGSLTLGLGGPFLLSSVSLRFCTPGPPALVLSAAWATGGPWRSLWRRPAWPGVLGGPER
VIFRVPAGPKASVVASHLRLELGGRGGLAAAGVRGRCQCHGHAARCAARDRPPRCRCRHH
TTGPGCESCQPSHRDWPWRPATPRHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCE
RCRHHTAGRHCHYCQPGFWRDPGQPISSRKACRACQCHPIGATGGACNQTNGQCSCKLGV
TGLTCNRCGPGYQQSRSPRMPCQRILEATTTLATTPHAYSSDPQCQNYCNTSDTRIHMSL
QRYCQQDYVLHAQVLASEAADTTWQRLAVRVLAVYKQGAQPVRRGSQAAWVPRADLTCGC
LRLRPASHYLLLGRTAGGPDPTRLVLDRHGLALPWRPRWARPLRRLQQEERAGGCRTLRP
STLSPEPRL
Download sequence
Identical sequences F1MF28
ENSBTAP00000053830 ENSBTAP00000053830 NP_001193801.1.59421 NP_001193801.1.76553 XP_005219438.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]