SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053831 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053831
Domain Number 1 Region: 262-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family Integrin beta EGF-like domains 0.026
Further Details:      
 
Domain Number 2 Region: 349-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number 3 Region: 183-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number 4 Region: 1-25
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000181
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Domain Number 5 Region: 75-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000197
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Domain Number 6 Region: 310-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Integrin beta EGF-like domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053831   Gene: ENSBTAG00000044027   Transcript: ENSBTAT00000061277
Sequence length 392
Comment pep:known_by_projection chromosome:UMD3.1:12:81980948:82108529:1 gene:ENSBTAG00000044027 transcript:ENSBTAT00000061277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGHGKCDCGRCKCDEGWFGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKC
DNSDGNGLVYGKFCECDDRECIDDETEEICGGKGHGKCYCGNCYCQAGWHGDKCEFQCDI
TPWESKRRCTSPDGKVCSNRGICVCGECSCHDVDPTGDWGDIHGDTCECDERDCRAVYDR
YSDDFCSGHGQCNCGRCDCKVGWYGKKCEHPRSCPLSTEESIRKCQGSATLPCSGRGKCE
CGKCTCYPPGDSKVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCEKGWFGTLCQHPR
KCNLTEEQSNSLCESADGILCSGKGSCHCGKCLCSAEEWYISGEFCDCDDRDCDKHDGLI
CTGNGICSCGNCECWDGWNGNACEIWLGTEYP
Download sequence
Identical sequences E1BK10
ENSBTAP00000053831 ENSBTAP00000053831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]