SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053852 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053852
Domain Number 1 Region: 14-123
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-22
Family Spermadhesin, CUB domain 0.00096
Further Details:      
 
Domain Number 2 Region: 198-300
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.23e-19
Family Platelet-derived growth factor-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053852   Gene: ENSBTAG00000043959   Transcript: ENSBTAT00000061070
Sequence length 307
Comment pep:known_by_projection chromosome:UMD3.1:17:43348702:43457620:1 gene:ENSBTAG00000043959 transcript:ENSBTAT00000061070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVQDPQHERIITVSTNGSIHSPRFPHTYPRNMDLVWRLVAVEENVWIQLTFDERFGLEDP
EDDICKYDFVEVEEPSDGTILGRWCGSGSVPGKQISKGNQIRIRFVSDEYFPSEPGFCIH
YNIVMPQLTETVSPSSLPASALPLDLLNNAVTAFSTLEDLIRYLEPDRWQLDLEDLYRPT
SLQLLGKNFVFGRKSRVVDLNLLKEEVRLYSCTPRNFSVSVREELKRTDTIFWPGCLLVK
RCGGNCACCLHTCSECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCV
CRGNPGG
Download sequence
Identical sequences E1BJY4
ENSBTAP00000053852 ENSBTAP00000053852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]