SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053932 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053932
Domain Number 1 Region: 2-57,88-143
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.01e-16
Family Laminin G-like module 0.0000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053932   Gene: ENSBTAG00000046199   Transcript: ENSBTAT00000064537
Sequence length 325
Comment pep:known chromosome:UMD3.1:11:32130133:32482612:-1 gene:ENSBTAG00000046199 transcript:ENSBTAT00000064537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNN
DNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYY
NGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTTTLATST
ARRGKPPTKEPVSQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAE
VIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAV
VKEKQPSSAKSANKNKKNKDKEYYV
Download sequence
Identical sequences G3MWM9
ENSBTAP00000053932 ENSBTAP00000053932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]