SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053956 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053956
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.41e-19
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053956   Gene: ENSBTAG00000048097   Transcript: ENSBTAT00000065860
Sequence length 64
Comment pep:known chromosome:UMD3.1:4:110971236:110971427:1 gene:ENSBTAG00000048097 transcript:ENSBTAT00000065860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGGWSPSDSDHYQWLQVNFGNRKQISAIATQGRYSSSDWVTQYRMLYSDTGRNWKPYHQD
GNIW
Download sequence
Identical sequences G3MWQ3 W5NTB7
ENSBTAP00000053956 ENSBTAP00000053956 ENSOARP00000001408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]