SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053958 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053958
Domain Number 1 Region: 12-79
Classification Level Classification E-value
Superfamily L domain-like 0.00000000544
Family Internalin LRR domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053958   Gene: ENSBTAG00000045648   Transcript: ENSBTAT00000065023
Sequence length 80
Comment pep:novel chromosome:UMD3.1:4:25032855:25050074:-1 gene:ENSBTAG00000045648 transcript:ENSBTAT00000065023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKSLKFIWGNHHNYLHGITFLTRNYCLAELYLNNNAIFDIEGLHYLPSLHILLLHHNELI
NLDATVKELKGMLNLKTLSI
Download sequence
Identical sequences G3MWQ5
ENSBTAP00000053958 ENSBTAP00000053958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]