SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053970 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053970
Domain Number 1 Region: 331-502
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.33e-41
Family SPRY domain 0.00044
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 1.37e-20
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 3 Region: 90-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000504
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053970   Gene: ENSBTAG00000004490   Transcript: ENSBTAT00000062975
Sequence length 509
Comment pep:known_by_projection chromosome:UMD3.1:23:28665990:28676508:1 gene:ENSBTAG00000004490 transcript:ENSBTAT00000062975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHQQFTGKLQEEMICPICLDILQDPATIDCGHNFCLSCITQSGEAADSVLKCPLCNKIV
KRDTITPNWLLVNLVEKIQAMDPSDMQPETEELRCLRHGEKCHYFCEVDGKFLCVVCRES
KDHKTHNTTLIEEAAQNYQGRIQSQIEVLQQKEREIIQVMAQGEHCIKVSMYQVELEKEM
VIEAFRQLRKVLKEEKSFLLSRINWLGQEISKGEKLYVTSTKSQLNYLRKLKDSLKSRQC
LPPGQLLQDIKIALCRSEAFRFLNPTPVSMDLEKKLSDIKSRHDSLTKSLKKFKDILQAD
SKKDKSKFLSGLSEEDRKSWWNLRDQETTLRAAYDPLTLDAASAHPDLIISQDLKTVTLK
PVPQRVCAGDTDPERFYPFRCVLGLPGLCSGCQTWEAELQGPEGGGCVVGVASELVPRKG
MLQIEPLSGFWALRIAGSECQALTETGTREDLSVCLRKVGVHVNHECGKVVFYDATTSNH
LYTFHASFPGQIFPFFRLLVPGTQITLSP
Download sequence
Identical sequences G3MWR7
ENSBTAP00000053970 ENSBTAP00000053970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]