SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054004 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054004
Domain Number 1 Region: 324-509
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.93e-67
Family SPRY domain 0.0000000495
Further Details:      
 
Domain Number 2 Region: 18-91
Classification Level Classification E-value
Superfamily RING/U-box 6.68e-23
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Domain Number 3 Region: 99-159
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.12e-17
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054004   Gene: ENSBTAG00000013900   Transcript: ENSBTAT00000063640
Sequence length 513
Comment pep:known chromosome:UMD3.1:15:51472486:51483656:1 gene:ENSBTAG00000013900 transcript:ENSBTAT00000063640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISPALLKRSITPMASAVPLTMMWEEVTCSICLDPMVEPMSIECGHSFCQECISEVGKEGG
SVCPVCRRHFLLQNLRPNRQVANMVDNLRKISQGAKESPHGELCVVHREKIHLFCEEDGK
ALCWVCSQSQKHRDHPMVPIEEAAQEYQEKLQVALNKLRHKQELAEKLELDIAMKKASWK
GKVEAHKLRIHEEFVRQKNFLAEEEQKQLQKLEEEERQQLRTLGDTEARLAQQIQALQEL
IAELERRRRGSALELLQEVKSVLERICSGLGRLINGHLSWSCWDSFKNCCCLVAELWSES
WNLKELDVASTDLRNVFYVPGIKKMLRTCGVHITLDPQTANPWLILSENRRQVRLANTRQ
EVPENEERFDSYPMVLGAQRFDSGKVYWEVDVTGKEAWDLGVCRDNVRRKGQFLLNSDTG
FWIIWLWNKQKYEAGTCPQTPLHLQVPPNRIGIFLDYEASTVSFYNITDHASLIYTFSEC
AFAGPLRPFFNPGFNDRGTNSAPLILCPLKTGW
Download sequence
Identical sequences G3MWU8
ENSBTAP00000054004 ENSBTAP00000054004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]