SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054057 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054057
Domain Number 1 Region: 648-842
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-45
Family SPRY domain 0.0000507
Further Details:      
 
Domain Number 2 Region: 22-116
Classification Level Classification E-value
Superfamily RING/U-box 9.42e-31
Family RING finger domain, C3HC4 0.0053
Further Details:      
 
Domain Number 3 Region: 357-442
Classification Level Classification E-value
Superfamily RING/U-box 1.9e-23
Family RING finger domain, C3HC4 0.0048
Further Details:      
 
Domain Number 4 Region: 118-180
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.04e-18
Family B-box zinc-binding domain 0.0017
Further Details:      
 
Domain Number 5 Region: 442-506
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000885
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054057   Gene: ENSBTAG00000037465   Transcript: ENSBTAT00000063426
Sequence length 844
Comment pep:known chromosome:UMD3.1:15:48531198:48568980:-1 gene:ENSBTAG00000037465 transcript:ENSBTAT00000063426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAHLPRIPNTRSTLEVRAGQAEARKVATMTSAVLVDIQDEVTCPICLELLTEPLSIDCGH
SFCQACITADNKESMPGQEGQSRCPVCQTSYWLGNLRPNRHLANIAERLREVVLGSGKQL
KVILCVHHGEKLQLFCEEDGKLICWLCERSQEHRGHHTFLMEEIAQEYQEKFQESLKKLR
QEQQEAEKLAAVIREKRISWKNQMEPERHRIQKQFDHLRSILDKEEQRQLKKLEEEERRG
LNIIAEAEVELVQQSQSLRELISDLEHRCQGSATELLQDVSDVAKRSEFWTLKKPEALPT
KLKSMFRAPDLKKMLRVFRELTDVQSYWGLISSGEVRRSSRRAPEVWTGGSQGAAAMALN
TVMNLQEEVSCPICRELLTEPLSLGCGHSFCQTCITNKETDISLGGDSSCPVCGTQYSLG
NLWPNLHLANIVERLRKVKLSPEEGQKTGLCVHHEEKLLLFCKEDRKVICRLCERSQEHH
GHHTFLMEEALKESQEMLQAALTRLRKEQQKAEKLEADIREERTSWKYQIQTERQRIQTE
FNQLRSILDSEEQRELQKLEEEEKKTLDSLAVAEAELVQQGELLKELISDLERRSEWSTV
ELLQDMSGIMKWSEIWTLKKPKTVSKKLKNVFRVPDLLGMLHTFKDLTRVQCHWVDITLN
PFNLNLNLVLSEDQRQVLSVPIWPVKYYNYGILGCQYFSSGKHYWEIDVSEKNAWILGVY
CRIRSCNIKFAVQQSTSYENAYSIYRPQFGYWVIGLKDKFRYEAFEDSSTTHPDSRVLTL
SMTVPPRHVGVFLDYEAGTVSFFNVTNHGSLIYKFSKCNFSRNAYPYFNPWDCPAPMTLC
PPSS
Download sequence
Identical sequences G3MWZ9
ENSBTAP00000054057 ENSBTAP00000054057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]