SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054101 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054101
Domain Number 1 Region: 31-237
Classification Level Classification E-value
Superfamily L domain-like 2.32e-35
Family Ngr ectodomain-like 0.0035
Further Details:      
 
Domain Number 2 Region: 285-363
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000425
Family I set domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054101   Gene: ENSBTAG00000045547   Transcript: ENSBTAT00000066173
Sequence length 512
Comment pep:known_by_projection chromosome:UMD3.1:22:51056714:51058249:1 gene:ENSBTAG00000045547 transcript:ENSBTAT00000066173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLVLQSTLLCLLRVGLGTQDSDSFLPHAPHNCPHKCVCAADLLDCAGLGLREVPVTLP
AAAADLDLSHNGLQRLPPGWLAPLSRLRALHLNHNELEALGRGVFTNASGLRLLDLSSNA
LRALGRHDLDGLGALETLLLFNNHLAHLDERAFHRLGTLSRLYLGCNKLSSFSFNHLHGL
GAAHLRILDLSSNHIGRTPVPDLAALPAFLKNGLYLHDNPLPCDCRLYHLLRRWHQRGLS
AVSDFAREYTCLAFKVPDSRVRFFAHSRVFENCSVALAQDLERPEEQLHVQVGQSLRLHC
NTSAPALRVAWVSPQHELLVAPGSRNGSIAVLADGSLAIGSVQPWHEGVFVCLATGPRLH
HNQTHEYNVSVSFPHPEPDAFNTGFTTLLGCAVGLTLVLLYLFAPPCPGCRRCCRRTCHC
CRRCRRWPQTPSPLRELSAQSSVLSTTPPDAPSRKASVHKHVVFLEPGRRGLNGRVQLAV
AEDFDLYNPSGLRLKAGSESTSPTASEGLVMT
Download sequence
Identical sequences G3MX42
ENSBTAP00000054101 ENSBTAP00000054101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]