SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054124 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054124
Domain Number 1 Region: 5-151
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.7e-53
Family Carbonic anhydrase 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054124   Gene: ENSBTAG00000001000   Transcript: ENSBTAT00000063585
Sequence length 155
Comment pep:known_by_projection chromosome:UMD3.1:14:79694162:79733755:-1 gene:ENSBTAG00000001000 transcript:ENSBTAT00000063585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFSWGYGERDGPVHWNEFFPIADGDQQSPIEIKTKEVRYDSSLRPLGIKYDASSAKII
SNSGHSFNVDFDDTDDKSVLRGGPLTGSYRLRQFHLHWGSTDDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGIFLQVWRWL
Download sequence
Identical sequences G3MX64
ENSBTAP00000054124 9913.ENSBTAP00000001324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]