SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054188 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054188
Domain Number 1 Region: 380-444
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.28e-19
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 894-956
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.05e-17
Family TB module/8-cys domain 0.00019
Further Details:      
 
Domain Number 3 Region: 637-764
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 768-887
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000122
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 1096-1148
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000275
Family TB module/8-cys domain 0.0022
Further Details:      
 
Domain Number 6 Region: 555-642
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 7 Region: 330-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000547
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 8 Region: 1004-1049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000881
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 263-328
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000432
Family TB module/8-cys domain 0.0026
Further Details:      
 
Domain Number 10 Region: 1228-1275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000114
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 11 Region: 106-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000439
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054188   Gene: ENSBTAG00000004757   Transcript: ENSBTAT00000063872
Sequence length 1280
Comment pep:known_by_projection chromosome:UMD3.1:18:50177282:50202098:1 gene:ENSBTAG00000004757 transcript:ENSBTAT00000063872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APRAGWGGGAAERGAAAMAGGARLLWVSLLVLLALLRPQPGLGRPRERLRVRFTPAVCGL
SCVHGPTGPRCTPTCAPRNTTSVDSGAPGGAAPGGPGFRAFLCPLICHNGGVCVKPDRCL
CPPDFAGKFCQLHSSGARPPAPAMPGFTRSVYTMPLANHRDDEHGEVSFFLLSTLLHRAL
FLHSYPRCLSPGVASMVSVHVEHPQEASVVVHQVERVSGPWEEADAEAVARAEAAARSEA
AAPYTVLAQSAPREDGYSDASGFGYCFRELRGGECASPLPGLRTQEVCCRGAGLAWGVHD
CQSCSELLGNTHQGGAPDGPCPTGFERVNGSCEDVDECATRGRCQHGECANTHGGYTCVC
PDGFLLDSSRSSCICEPPEAKGPCFRVLRDGGCSLPILRNITKQICCCSRVGKAWGRGCQ
LCPPFGSEGFREICPAGPGYHYSASDLRYNTRPLGQEPPRVSLSQPRAPPSTSRPPSGSP
KKGEMIRDTQIKVSNADTPSLPGFLPTHRPEPRPEPRPGPELPLPSIPAWTGPGIPESDS
KCSVNVRQVIFVEDSECQRNPQVCGRGRCIPRPSGYTCACDSGFRLSPQGTHCIDVDECR
RVPTPCAPGRCENTPGSFRCVCGPGFRAGPRGTECLDVDECIQSPGLCGRGVCENLPGSF
RCVCPAGFRGSACEEDVDECAQEPPPCGPGRCDNTVGSFHCACPAGFRSRGPGAPCQDVN
ECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTDG
SFECICPPGHRAGPDLASCLDIDECQEYGPAICGAQRCENTPGSYRCTPACDPGYQPTPG
GGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCETVSRPSGRRECYFD
TAAPDACDNILARNVTWQECCCTVGEGWGSGCRIQQCPSTETAEYQSLCPHGRGYLAPSG
DLSLSHTLPSPDPAHPTTWPSPISGEARASDQRGGGYFINHSLHASLDNDECADEEPACE
GGRCVNTIGSYHCTCEPPLVLDGSRRRCVSNESQSLGEVFPRPAPSIISPAHAVQPLLTS
ASGLGFWLSELEASWRDDNLGVCWQEVGADLVCSRPRLDRQATYTECCCLYGEAWGMDCA
LCPAQDSDLSPGSRTPDPNPETPTRSFDTPLMPQPKPLPPSPPGSSSLRGDINSRCRGSR
ALCNVLRPPAYGPPRPGGFGLPYETSICNDNINECDEAEAAAPLCVNARCVNTDGSFRCI
CRPGFAPSHEPHHCTPARPR
Download sequence
Identical sequences G3MXC3
ENSBTAP00000054188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]