SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054245 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054245
Domain Number 1 Region: 1-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000184
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 42-88
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000607
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054245   Gene: ENSBTAG00000047323   Transcript: ENSBTAT00000063684
Sequence length 275
Comment pep:known chromosome:UMD3.1:28:29087621:29095422:-1 gene:ENSBTAG00000047323 transcript:ENSBTAT00000063684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DENECEQNNGGCSEICVNLKNSYRCECGIGRVLRSDGKTCEDIEGCHNNNGGCSHSCLTS
ETGYRCECPRGLVLSEDNHTCQVPVFCKSNTIEVSIPRDLVGGLELFLTNTSCRGVSNGT
HVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDIIIRTSKLLIPVTCEFPRL
YTISEGYVPNLRNTPLEIMSRSHGIFPFTLEIFKDHEFEEPYREALPTLKLRDSLYFGIE
PLVHVNGLESLVESCFATPTSKIDEIMKYYIIQDG
Download sequence
Identical sequences G3MXH8
ENSBTAP00000054245 ENSBTAP00000054245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]