SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054276 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054276
Domain Number 1 Region: 64-240
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-28
Family Laminin G-like module 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054276   Gene: ENSBTAG00000010050   Transcript: ENSBTAT00000065364
Sequence length 1592
Comment pep:known_by_projection chromosome:UMD3.1:2:122557458:122611951:1 gene:ENSBTAG00000010050 transcript:ENSBTAT00000065364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWASWAPGLWLLSLYVTYSHGADAGEQCPPSQQEGLKLEHRSDLSTNVTGFNLIHRLSLM
KTSAVKKIRNPKGPFILRLGAVSVTQPTRRVFPRGLPSEFALVLTLLMKKHTHRNTWYLF
QVTDGDGYPQISLEVNSQEQSLELRTRGQDGDFVSCIFSVPQLFDLRWHKLVLSVAERVA
SVHVDCMSASSQPLGPRRSIEPVGHVFLGLDAEQGKPVSFDLQQAHIYCDPEFVLEEGCC
EILPGGCPPETSKARRDTQNNELIEINPQTEGKVYTRCFCLEEPQNSKVDAQLSGRISQK
PERGAKAHQETAADECPPCVHGAQESNVTIGPSGPQGGKGERGLPGPSGPKGEKGARGND
CVRISPDAPLQCAEGLKGEKGESGALGPSGLPGSTGQKGQKGEKGDGGVKGSPGKPGRDG
RPGEVCVIGPKGQKGDPGFVGPEGLAGEPGPPGLPGPPGIGLPGTPGDPGGPPGPKGDKG
NSGVPGKEGPGGKPGKPGVPGLKGEKGDPCEVCPTLPEGFQNFVGLPGKPGPKGEPGDPA
PARESLGAVGQKGDRGDPGIQGLKGEKGESCSSCSFAVAAQHLQPSAGAKGDVGPPGLGL
PGLPGKAGAPGPTGLKGEKGNFGEVGPAGNPGPPGPAGPTGIKGEKGEPCEPCRALTEHQ
DEDSHVVALPGPRGEKGEPGPPGFGLPGKQGKAGERGLKGQKGDAGNPGDPGTPGITGRP
GLSGEPGVRGPVGPKGEKGDGCTACPSTQGALTDRAGPPGKPGPKGDPGPEGVGRPGKPG
QPGLPGVQGPPGLKGIQGEPGPPGVGVQGPQGEPGAQGLPGIQGLPGPRGPPGPAGEKGA
KGSPGVKGAAGPVGPPGASVSGPPGEKGSQGEKGEPGECSCPSRGDLIFSGMPGAPGLWM
GSSWQPGPQGPPGVPGPPGPPGMPGLQGVPGHNGLPGQPGLTAELGSLPIEQHLLKSICG
DCIQGKMAHEVALMESGEKGDQGIPGVPGLDSCTQCFMERERPRAEEARGDNHEGDPGCA
GSPGLPGPPGLPGQRGEEGPPGMRGSPGRRGQKGLQGERGLRGLTGEKGEPGPPGQPGYP
GAMGPPGLPGIKGERGYAGSPGEKGESGPPGSEGLPGPPGPAGPRGERGPQGSSGEKGDQ
GFQGQPGFPGPPGPPGFPGKAGAPGPPGPQADKGSEGIRGPSGLPGPPGPPGSPGIQGPA
GLDGLDGKDGKPGLRGDPGPAGPPGLMGPPGFKGKPGHPGLPGQKGDCGKPGPQGSSGRP
GAEGEPGAMGPQGRPGPPGHVGPPGPPGQPGPAGISAVGPKGDRGATGERGLLGLPGQPG
PPGHPGPPGEPGMDGAAGKEGPPGKQGLYGPPGPKGDPGPSGQKGQAGEKGRAGMPGGPG
KSGSMGPAGPPGPAGERGHPGSPGPAGSPGLPGVPGSMGDMVNYDEIKRFIRQEIIKMFD
ERMAYYTSRMQFPMEMAAAPGRPGPPGKDGPPGRPGSPGSPGLPGQIGREGRQGLPGMRG
LPGTKGEKGDIGVGIAGEIGLPGPPGPQGPPGYGKMGATGPMGQQGIPGIPGPPGPIGPP
GKTGHCNPSDCFGAMPMEQQYPPMKNMKGPFG
Download sequence
Identical sequences G3MXK9
ENSBTAP00000054276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]