SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054294 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054294
Domain Number 1 Region: 142-361,388-489
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.94e-66
Family Pancreatic carboxypeptidases 0.00000567
Further Details:      
 
Domain Number 2 Region: 12-124
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.87e-38
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00038
Further Details:      
 
Domain Number 3 Region: 489-581
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.16e-21
Family Carboxypeptidase regulatory domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054294   Gene: ENSBTAG00000012237   Transcript: ENSBTAT00000064740
Sequence length 728
Comment pep:known chromosome:UMD3.1:4:77881913:77888187:-1 gene:ENSBTAG00000012237 transcript:ENSBTAT00000064740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAGDTEDDYYDGAWCAEDDSQTQWIEVDTRRTTKFTGVITQGRDSSIHDDFVTSFFVGF
SNDSQTWVMYTNGYEEMTFHGNVDKDTPVLSELPEPVVARFIRIYPLTWNGSLCMRLEVL
GCPVSPVHSYYAQNEVVTTDDLDFRHHNYKDMRQLMKVVNEQCPTITRTYSLGKSSRGLK
IYAMEISDNPGDHELGEPEFRYTAGIHGNEVLGRELLLLLMQYLCREYRDGNPRVRSLVQ
DTRIHLVPSLNPDGYEVAAQMGSEFGNWALGLWTEEGFDIYEDFPDLNSVLWGAEERKWV
PYRVPNNNLPIPERYLSPDATVSTEVRAIIAWMEKNPFVLGANLNGGERLVSYPYDMART
PSQEQLLAAAMAAARGEDEEEVSEAQETPDHAIFRWLAISFASTHLTMTEPYRGGCQAQD
YTGGMGIVNGAKWKPRSGTINDFSYLHTNCLELSIFLGCDKFPHESELPREWENNKEALL
TFMEQVHRGIKGVVTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAE
GYTPSSKTCNVDYDIGATQCNFILARSNWKRIREIMAMNGNRPIPRIDPSRPMTPQQRRM
QRRRLQYRLRMREQMRLRRLNATTSPATTPTSPPPTPTLLPTADLAPSPAPSSTLGPWQF
LPETTVNWEESETETETETETYTEVVTEFGTELGPEEEEGEEGEGEMVTGPDFPFTTVET
YTVNFGDF
Download sequence
Identical sequences G3MXM6
ENSBTAP00000054294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]