SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054322 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054322
Domain Number 1 Region: 56-128
Classification Level Classification E-value
Superfamily Histone-fold 3.14e-22
Family TBP-associated factors, TAFs 0.000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054322   Gene: ENSBTAG00000026306   Transcript: ENSBTAT00000037324
Sequence length 161
Comment pep:novel chromosome:UMD3.1:14:23067159:23068103:-1 gene:ENSBTAG00000026306 transcript:ENSBTAT00000037324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQFGPSALINLSNFSSIKPEPASTPPQGSMASSTAVVKIPGTPGTGGRLSPESNQVLTK
KKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKNVQLHL
ERQWNMWIPGFSSEEIRPYKKACTTEAHRIKKLLIEKKQNK
Download sequence
Identical sequences G3MXQ4
ENSBTAP00000054322 ENSBTAP00000054322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]