SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054397 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054397
Domain Number 1 Region: 28-304
Classification Level Classification E-value
Superfamily L domain-like 2.65e-62
Family Ngr ectodomain-like 0.000000000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054397   Gene: ENSBTAG00000046677   Transcript: ENSBTAT00000065527
Sequence length 473
Comment pep:known_by_projection chromosome:UMD3.1:17:75103302:75104723:-1 gene:ENSBTAG00000046677 transcript:ENSBTAT00000065527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTSPLPAGSQLLAWVLWLQAWRVAAPCPGACVCYSEPKVTTSCPQQGLQAVPADIPAASQ
RVFLHGNRIAYVPAASFRACRNLTILWLHSNALAHIDAAAFSGLALLEQLDLSDNAQLRA
VDPATFRGLGRLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNGLQALPDDAFSDLGNL
THLFLHGNHIPSVPERAFRGLHSLDRLLLHQNRVARVHPHAFRDLGRLMTLYLFANNLSA
LSAEALAPLRSLQYLRLNDNPWVCDCRARPLWAWLQQFRGSSSELPCSLPARLAGRDLKR
LAATDLEGCAVATLPAPPIWTGGPVHEEPLGLPKCCQPDAVDKASVLEAGRPASAGNALK
GRVPPGDSAPGNRSGPRHINDSPFGTLPGSAEPPLTAVQPEGSQPPGSPNTGPRRRPGCS
RKNRTRSQCRLGQAGSGGGGSGAVEGSGTPSGLACSLVPLALAPVLWTVLGRC
Download sequence
Identical sequences G3MXX5
ENSBTAP00000054397 ENSBTAP00000054397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]