SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054420 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054420
Domain Number 1 Region: 213-440
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.69e-39
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 2 Region: 463-656
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-28
Family Laminin G-like module 0.026
Further Details:      
 
Domain Number 3 Region: 153-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 789-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000197
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 5 Region: 695-741
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000114
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 660-694
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000136
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054420   Gene: ENSBTAG00000018804   Transcript: ENSBTAT00000063317
Sequence length 1482
Comment pep:known chromosome:UMD3.1:3:34246149:34270501:-1 gene:ENSBTAG00000018804 transcript:ENSBTAT00000063317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPERFLSPLLGLFIQAVAATLATPPDHVVIFNVQRDTDAPGSHILNVSLSVGQPPGPGG
GPPFLPSEDLQERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSAPF
IASSSVLFRPIHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCGPHGHCRSREGGYTCLCR
DGYTGEHCEVSARSGRCTPGVCKNGGTCVNLLVGGFKCNCPSGDFEKPFCQVTTRSFPAR
SFITFRGLRQRFHFTLALSFATKERDGLLLYNGRFNEKHDFVALEVIQEQVQLTFSAGES
TTTVSPFVPGGVSDGQWHTVQLKYYNKPLLGQTGLPQGPSEQKVAVVTVDGCDTGVALRF
GAMLGNYSCAAQGTQGGSKKSLDLTGPLLLGGVPDLPESFPVRTRQFVGCIRNLQVDSRH
VDMADFIANNGTMPGCPAKKNVCDSNSCHNGGTCVNQWDAFSCECPLGFGGKSCAQEMAN
PQRFLGSSLLAWHGLSLPISQPWHLSLMFRTRQADGVLLQAVTRGRSTITLQLREGRVVL
SVEGTGLQASSLQLEPGRANDGDWHHAQLALGASGGPGHAILSFDYGQQRAEGNLGPRLH
GLHLSNVTVGGVPGPASGVARGFRGCLQGVRVSETPEGVSSLDPSRGESINVEPGCSLPD
PCDSNPCPANSYCSDDWDSYSCSCDPGYYGDNCTNVCDLNPCEHQSMCTRKPSAPHGYTC
ECPPSYLGPYCETRIDQPCPRGWWGHPTCGPCNCDVSKGFDPDCNKTSGECHCKENHYRP
PGSPACLLCDCYPTGSLSRVCDPEEGQCPCKPGVIGRQCDRCDNPFAEVTTNGCEVNYDS
CPRAIEAGIWWPRTRFGLPAAAPCPKGSFGTAVRHCDEHRGWLPPNLFNCTSVTFSELKG
FAERLQRNESGLDSGRSQRLALLLRNATQHTAGYFGSDVKVAYQLATRLLAHESAQRGFG
LSATQDVHFTENLLRVGSALLDAANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHT
YLSPFTIVTPNIVISVVRLDKGNFAGAKLPRYEALRGERPPDLETTVILPESVFRETPPV
VRPAGPGEPQEPEELARRQRRHPELSQGEAVASVIIYRTLAGLLPHNYDPDKRSLRVPKR
PVINTPVVSISVHDDEELLPRALDKPVTVQFRLLETEERTKPICVFWNHSILVSGTGGWS
ARGCEVVFRNESHVSCQCNHMTSFAVLMDVSRRENGEILPLKTLTYVALGVTLAALLLTF
LFLAVLRTLRSNQHGIRRNLTAALGLAQLVFLLGINQADLPFACTVIAILLHFLFLCAFA
WALLEALHLYRALTEVRDVNAGPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWLSI
YDTLIWSFTGPVAFAVSMSVFLYILAARASCAAQRQGFEKKGPVSGLRPSFAVLLLLSAT
WLLALLSVNSDTLLFHYLFAASNLPSPKGKDEATCTQGIVPC
Download sequence
Identical sequences G3MXZ5
ENSBTAP00000054420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]