SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054460 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054460
Domain Number 1 Region: 89-233
Classification Level Classification E-value
Superfamily L domain-like 5.44e-27
Family Internalin LRR domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054460   Gene: ENSBTAG00000048263   Transcript: ENSBTAT00000063677
Sequence length 540
Comment pep:known_by_projection chromosome:UMD3.1:29:51078395:51091214:-1 gene:ENSBTAG00000048263 transcript:ENSBTAT00000063677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQARDGAHGSRPSTASIQVRELSSQGLHNPQPQSKAPGRSGHGHSEQLAEECLLPARLQ
ALAQVDDLRLVSMLEMCVNTRESSLGSLGLHLPNLSQLKLNGSCLGSLRDLGTSLSHLQV
LSQTRCSLTDLESISSFPALKELYLSYNNIWDLSPLCLLEQLEVLDLEGNCVEDLGQLRY
LQLCPQLATLTLEGNPLCLRPGSGPTHQVPQGYNYRAEVRKLIPQLQVLDELPAAHTGLP
ASQKLDQDWLLVKEAIKEGCTLDSLHQTHGSPMWRLSPELCLPETQPWAPRRGPLSLLVP
GMPLPEGLLPKGPAPEDGTSNLTHGAGRVLCGNPTKGLRERRHGCQAGVHPEKLPSPRLE
ELAPRASASEPDPADDHDLLAWAGLQALRELRLRPLPSRCPESWEEGAAGPWGPQRGPEE
QEDEAGPKPHRSPPSLAPESSRTSGYNLIPCPPKSFKPDRGRNSWGSTDLQFRGRRLRTL
GSLGPGLGQGLAPVTALRAREVTSGPSPQAEGCPGPKPAPDSAARPPASGDTDHPSPTPP
Download sequence
Identical sequences G3MY33
ENSBTAP00000054460 ENSBTAP00000054460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]