SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054502 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054502
Domain Number 1 Region: 102-374
Classification Level Classification E-value
Superfamily L domain-like 2.72e-49
Family Ngr ectodomain-like 0.0042
Further Details:      
 
Domain Number 2 Region: 55-122
Classification Level Classification E-value
Superfamily L domain-like 0.000000544
Family Ngr ectodomain-like 0.0037
Further Details:      
 
Domain Number 3 Region: 444-513
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000906
Family Fibronectin type III 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054502   Gene: ENSBTAG00000048264   Transcript: ENSBTAT00000065908
Sequence length 677
Comment pep:known_by_projection chromosome:UMD3.1:29:43048588:43050621:1 gene:ENSBTAG00000048264 transcript:ENSBTAT00000065908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVAHPTAAAATTATPATTVTATVVMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVC
RCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDL
DEFPVNLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQ
LKLLFLSRNHLSSIPSGLPRTLEELRLDDNRISTIPLHAFKGLSSLRRLVLDGNLLANQR
IADDTFSRLQNLTELSLVRNSLAAPPLNLPSARLQKLYLQDNAISHVPYNTLAKMRELER
LDLSNNNLTTLPRGLFDDLENLAQLLLRNNPWFCGCNLLWLRDWVKARAAVVNVRGLMCQ
GPEKVRGMAIKDITSEMDECFEAGAQGGAVNAAAKTTHASDHASVTTPQGSLFTLKAKRP
GLRLPDSSLDYPMATGDSAKTLAIHVKPLTADSIRITWKATLPASSFRLSWLRLGHSPAV
GSITETLVQGDKTEYLLTALEPKSTYIICMVTMDTGNTYVADETPVCAKAETADSSGPAT
TLNQEQNADPMAGLPLAGIIGGAVALVFLFLVLGAICWYVHRASELLTRERAYNRGSRKK
DDYLESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKGTHTIGYGT
TRGYRDGGIPDIDYSYT
Download sequence
Identical sequences G3MY74
ENSBTAP00000054502 XP_005197393.1.59421 XP_005227270.1.76553 XP_005894195.1.15283 XP_015316787.1.76553 XP_015316788.1.76553 XP_015325545.1.59421 XP_015325546.1.59421 ENSBTAP00000054502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]