SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054517 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054517
Domain Number 1 Region: 61-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.65e-87
Family Calnexin/calreticulin 0.00000000275
Further Details:      
 
Domain Number 2 Region: 270-410
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.48e-58
Family P-domain of calnexin/calreticulin 0.0000000315
Further Details:      
 
Domain Number 3 Region: 412-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000269
Family Calnexin/calreticulin 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054517   Gene: ENSBTAG00000048107   Transcript: ENSBTAT00000064711
Sequence length 593
Comment pep:known chromosome:UMD3.1:7:1506750:1538915:-1 gene:ENSBTAG00000048107 transcript:ENSBTAT00000064711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGKWLLCMLLVLGTALVQAHDGHDDDVIDIEDDLDDVIEEVEDSKSKPDASSPPSPKVT
YKAPVPTGEVYFADSFDRGTLSGWILSRAKKDDTDDEIAKYDGKWEVDEMKESKLPGDKG
LVLMSRAKHHAISTKLNKPFIFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQF
HDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYT
LILNPDNSFEILVDQSVVNSGNLLHDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPDAV
KPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAERPEDWDEDMDGEWEAPQIANPK
CESAPGCGVWQRPMIDNPNYKGRWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPF
SAIGLELWSMTSDIFFDNFIVCGDRRVVDDWANDGWGLKKAADGASEPGVVGQMIEAAEE
RPWLWVVYILTVALPVFLVILFCCSGKKQASPVEYKKTDAPQPDVKEDEEEKEEEKEKGD
EEEDGEEKLEEKQKSDVEEDGDTVSQEEDDRKPKAEEDEILNRSPRNRKPRRE
Download sequence
Identical sequences A7Z066
ENSBTAP00000054517 NP_001099082.1.59421 NP_001099082.1.76553 ENSBTAP00000054517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]