SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054561 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054561
Domain Number 1 Region: 96-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000678
Family Cripto EGF-like domain-like 0.00043
Further Details:      
 
Domain Number 2 Region: 63-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000559
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054561   Gene: ENSBTAG00000046283   Transcript: ENSBTAT00000064931
Sequence length 170
Comment pep:novel chromosome:UMD3.1:19:9891232:9892158:-1 gene:ENSBTAG00000046283 transcript:ENSBTAT00000064931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERFSYSVILIMAFSRALELGLVAGGELAFRDDGLWSQEEPAIRQQPSQFVASMGIQESK
KLRRTCCLNGGTCMLGSFCACPPSFYGRNCEHDSCKENCGSVPHDTWLPRKCSMCKCWHG
QLRCFPQSFLPGCDSHVMDEHLTASRTSELTLSACALMLPGICLAIQIKI
Download sequence
Identical sequences G3MYC9
ENSBTAP00000054561 ENSBTAP00000054561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]