SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054662 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054662
Domain Number 1 Region: 677-815,889-1037,1107-1166
Classification Level Classification E-value
Superfamily L domain-like 2.04e-41
Family Internalin LRR domain 0.018
Further Details:      
 
Domain Number 2 Region: 54-238
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 6.02e-32
Family Outer arm dynein light chain 1 0.00091
Further Details:      
 
Domain Number 3 Region: 1201-1370
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 6.93e-32
Family Outer arm dynein light chain 1 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054662   Gene: ENSBTAG00000003090   Transcript: ENSBTAT00000062967
Sequence length 1381
Comment pep:known_by_projection chromosome:UMD3.1:10:72413702:72514374:1 gene:ENSBTAG00000003090 transcript:ENSBTAT00000062967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIECENINQHDIIKELCLCNGLSYEMIGQEGSDTSKLEMFFSGYPRIVGLSLFPNLTSLT
IVAQDIKEISGLETCLQLKELWIAECCIEKIGGLQECRSLEKLYLYYNKISKIENLEKLS
RLEVLWLNHNAIKYIEGLQTLKNLSDLNLAGNLISSIVKGRCLDPNEQLERLNLSGNQIC
SFKDLTNLTRLRHLKDLCLNDPQYKTNPVCLLCNYSTHVLYHLPCLQRLDTFDVSPKQIK
ELADTTAMKKIMYYNMRIKTVQRHLNEDLEKLNDRKCKLQKLPEERIKLFNFLKKNLERE
LTELKGSGKGHNDRSNNNKVTELEKSKICETVTEEPSLQQKIVIKLNALNERVTFWNKKL
DEIEAIYRIEVKRKKKSHSLLIPFLLIELETVGNIHFEEGTRSDDWFNSCYELILSRFCT
WDFRTYGITGVKVKRVIKVNNRILRLKFEEKFQKFLDNEHMHDSESYRKMLECLFYVFDP
EITVKKKHLLQILEKGFKDSETSKLPLRKEAVILANSLSICECPRIEILQQKYKDEKKNS
LEHELFRHGILLITKVFLGQSVQAHDHDSISQANYPMINSVFIPRKYLLNSIMGQRNCDC
SVRQCKWFVFDHDLVLPEYIVEFEYITVVKAHSLFSSFNNVILEESKKNSEGSVLSQDLK
FDDEVIKMDPRIKPRPKLISLDDKTILSLAKTSVYGHIVSLNLHGNSLSKLRDLSKLTGL
RKLNISFNEFTCLDDVYHLYNLEYLDASHNHVITLEGFRGLMKLKHLDLSWNQLKKSGDE
INMLCKHTTSLLTLDIRHNPWQKPATLRLSVIGRLKTLTHLDGVLISEEEATAAMKFISG
TKITQFSLLRHSSTKEERPRILSIWPSAKILTQTSKLGPHSHMSGNWYLKITALNLDGQH
LFEITNLEKLENLKWASFSNNNLTKMEGLESCVNLEELTLDGNCISKIEGISKLTKLTHL
SINNNLLTGLEKHIFDNMLHLHSLSLENNRITSLSGLQKAFTLIELYVSNNYIALNQEIY
NLKGLCNLVILDMYGNIIVWNQENYRLFVIFHLPELKALDGISIEPPETECAKDLFGGRL
TSDMIAERQGHPNFTQMQELNWTSSSIRTVDLIPVDQFRNVCNVNLQNNNLTSFSGLIYL
PNVKVLCLNYNHIESIIPRLKPQTHLTSRQLLYQKVPSSGYGQQGTSKMNRDTTSSENLP
PIMNSLEVLHLGYNGICNLIQLQLNRLRNLKFLFLQGNEISQIEGLDNLEVLQELVVDHN
RIRAFNDSAFAKPSSLLALHLEENRLRELSKLQPLVKLEKLFLGYNKIQDMAELEKLDGI
SSLRELTVYGNPICRKMLHRHVLIFRLPNLQMLDGIPVNSDDRAKAEFHFSELQAKKNSV
I
Download sequence
Identical sequences G3MYM6
ENSBTAP00000054662 ENSBTAP00000054662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]