SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054672 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054672
Domain Number 1 Region: 63-100
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.0000000000000144
Family Ribosomal protein L36 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054672   Gene: ENSBTAG00000047906   Transcript: ENSBTAT00000064878
Sequence length 100
Comment pep:known_by_projection chromosome:UMD3.1:20:70995210:70996377:1 gene:ENSBTAG00000047906 transcript:ENSBTAT00000064878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATALLRRVASAVGPLLQLGGRPLSALAQGPPRAGPATHTPPGLVATLLAARPALGLQPA
LGFKTKGVLKKRCKGCYLVKRRGRWFIYCKTNPKHKQRQM
Download sequence
Identical sequences G3MYN6
XP_002696509.2.76553 XP_580819.3.59421 ENSBTAP00000054672 ENSBTAP00000054672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]