SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054691 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054691
Domain Number 1 Region: 24-113
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-20
Family V set domains (antibody variable domain-like) 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054691   Gene: ENSBTAG00000047001   Transcript: ENSBTAT00000066245
Sequence length 123
Comment pep:novel chromosome:UMD3.1:10:23549339:23549910:-1 gene:ENSBTAG00000047001 transcript:ENSBTAT00000066245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLAGTVLGLLFAQVCCVQGLDVEQSPPALSLQEGASHMLRCNFSASVSNVQWYLQNPS
GRLIHLFNIPSGTKQDGRLNATTIPKERRSSLHISSSQTTDSGTYFCAVQHSAPQAPAAS
TQT
Download sequence
Identical sequences G3MYQ4
ENSBTAP00000054691 ENSBTAP00000054691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]