SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054723 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054723
Domain Number 1 Region: 61-344
Classification Level Classification E-value
Superfamily L domain-like 1.9e-43
Family Ngr ectodomain-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054723   Gene: ENSBTAG00000039477   Transcript: ENSBTAT00000056163
Sequence length 420
Comment pep:known_by_projection chromosome:UMD3.1:9:22454647:22455909:1 gene:ENSBTAG00000039477 transcript:ENSBTAT00000056163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGCSRGPAAGDGRLRLARLALVLLGWVSSTSLPSSASSSTSSASLPAPAASGQPALPG
RCPAPCECSEAARTVKCVNRNLTEVPADLPPYVRNLFLTGNQLAVLPAGAFARRPPLADL
AALNLSGNRLKEVDAGAFEHLPGLRQLDLSHNPLADLSPFAFSGSNASVATPSPLAELIL
NRLELPAAERQNLSLEGMVAAALRAGHALRGLRRLELASNQLLYLPHDVLAHLPGLRHLD
LRNNSLVGLTHVSFRNLTHLESLHLEDNALKVLRNGTLAELQSLPHVRVFLDDNPWVCDC
HMVDMVAWLKETEVVQGKGRLTCAFPEKMRHRVLLELNSSDLDCDPILPPSLQTSYVFLG
IVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV
Download sequence
Identical sequences G3MYT4
XP_002690093.1.76553 XP_593502.3.59421 ENSBTAP00000054723 ENSBTAP00000054723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]