SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054736 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054736
Domain Number 1 Region: 647-814
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-39
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 458-553
Classification Level Classification E-value
Superfamily Fibronectin type III 3.73e-19
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 242-303
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.3e-16
Family B-box zinc-binding domain 0.0011
Further Details:      
 
Domain Number 4 Region: 3-44
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000264
Family RING finger domain, C3HC4 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054736   Gene: ENSBTAG00000047877   Transcript: ENSBTAT00000063258
Sequence length 845
Comment pep:known_by_projection chromosome:UMD3.1:28:3460169:3520219:-1 gene:ENSBTAG00000047877 transcript:ENSBTAT00000063258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAMEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDDQEAAAGPACSGAGGSAA
GGLGGGAGGGSDHADKLSLYSETDSGYGSYTPSLKSPNGVRVLPMVPAPPGSSAAAARGA
ACSSLSSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEAIVQRYQQGRGAAPGASAVTAV
AICQLCDRTPPEPAATLCEQCDVLYCAACQLKCHPSRGPFAKHRLVQPPPPPAPSEVASG
YTARKYPTCPEHEMENYSMYCLTCRTPVCYLCLEEGRHGKHEVKPLGAMWKQHKAQLSQA
LNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTK
EREHKLKMVWDQINHCTLKLRQSTGLMEYCLEVIKENDPAGFLQISDALIKRVQVSQEQW
VKGALEPKVSAEFELTLDSEPLLQAIHQLDFIQMKCRVTVPPVPLLQLEKCCTRNNSVTL
AWRTPPFTHSPVDGYILELDDGDGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSG
VGPYSKTVVLQTSDGAKSGWDVPEKRRQEAARRNLPLEHPVPELRFSLIPAHPLAALRNT
GQPEPPPRDEQMVLSQEWAPQLCAPRSPHLPAGCRWMTERRSFGDPTSPLCLSSLAWFTF
DPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGAHYWELHVDRYDNHPDPAFGVAR
ASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTF
FINGQQQGPTAFSHVDGVFMPALSLNRNVQIDLWGLTHKSISACVFVPPFICKRALRQPK
QAPGP
Download sequence
Identical sequences G3MYU7
ENSBTAP00000054736 ENSBTAP00000054736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]