SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054756 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054756
Domain Number 1 Region: 221-379
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.76e-58
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000191
Further Details:      
 
Domain Number 2 Region: 113-219
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.81e-26
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00082
Further Details:      
 
Domain Number 3 Region: 26-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000722
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 67-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000027
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054756   Gene: ENSBTAG00000003300   Transcript: ENSBTAT00000065341
Sequence length 379
Comment pep:known_by_projection chromosome:UMD3.1:21:20889913:20904968:-1 gene:ENSBTAG00000003300 transcript:ENSBTAT00000065341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCPRLLAALCGALFCSSGLFAFSGDFCDSSQCLHGGTCLLNEDRTPPFYCLCPEGFTGL
LCNETEHGPCFPNPCHNDAECQVTDDSHRGDVFIQYICKCPLGYVGIHCETTCTSPLGMQ
TGAIADSQISASSMHLGFMGLQRWAPELARLHQTGIVNAWTSGNYDKNPWIQIFIGNVNN
SGLKINLFDTPLETQYVRLVPIICHRGCTLRFELLGCELNGCTEPLGLKDNTIPNKQITA
SSYYKTWGLSAFSWFPYYARLDNQGKFNAWTAQTNSASEWLQIDLGSQKRVTGIITQGAR
DFGHIQYVAAYRVAYGDDGVTWTEYKDPGASESKIFPGNMDNNSHKKNIFETPFQARFVR
IQPVAWHNRITLRVELLGC
Download sequence
Identical sequences G3MYW7
ENSBTAP00000054756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]