SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054766 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054766
Domain Number 1 Region: 310-502
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.55e-18
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 2 Region: 719-917
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-17
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 3 Region: 517-672
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-17
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 4 Region: 38-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000196
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 5 Region: 154-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000002
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 6 Region: 76-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000243
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 7 Region: 250-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000322
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 8 Region: 114-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000429
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 9 Region: 1102-1139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000876
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 10 Region: 946-982
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family EGF-type module 0.008
Further Details:      
 
Domain Number 11 Region: 1-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000034
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 12 Region: 192-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000336
Family EGF-type module 0.015
Further Details:      
 
Domain Number 13 Region: 983-1021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000104
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054766   Gene: ENSBTAG00000014391   Transcript: ENSBTAT00000065835
Sequence length 1206
Comment pep:known_by_projection chromosome:UMD3.1:11:94509179:94523379:1 gene:ENSBTAG00000014391 transcript:ENSBTAT00000065835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CASQPCHHGALCVPQGPGPDDFRCYCVPGFQGPHCELDIDECASRPCHHGATCRNLADRY
ECHCPLGYEGVTCETEVDECASAPCLHGGSCLDGVGSYRCVCAPGYGGASCQLDLDECQS
QPCAHGGVCRDLVNGFRCDCADTGYEGERCELEVLECASAPCANNASCLEGLGSFRCLCW
PGYSGERCEVDEDECAVGPCQHGGQCLQRSDPTLYGGIQATFPDDFSFRQAAGFVCRCPP
GFEGPTCQEDMDECLSEPCLHGGTCEDTVAGYICGCPEAWGGLDCSVPLTGCQGHTCPPT
ATCVPTFESGVHSYTCRCPPGTHGPFCGQNTTFSMVAGNPLRASVPAGSSLGLALRFRTT
IRVGALATCSDTQGSVELALVEARLQATLWSHGKNVLVLRLLEPPLNDGHWHRVEVTLRL
GVLELRLWHEDCPAHLCVASSPMATAAPAPTPAGSRFTQLGGVAFAGCLQDVQVDGHLLL
PEDLGENVLLGCWHQEHCQPPPCAHGGVCVDLWTHFHCDCPRPYRGPTCADEVPAATFGL
GGTLSSASFLLDQPPGPNLTVSFLLRTREPAGLLLQLTNGSAAGLTVFLSEGQIWAEALG
SPALVLPGRWDDGLRHLVTLSFGPDQLWGVGQQVHVGGRLLPGDAEPWGGPFRGCMQDVR
LNDLHLPFFPPLLGNSSLPSVPGRGQSWNLTMGCISEDTCNPEPCLNGGTCLVTWNDFHC
TCPANFTGPTCAQQLWCPGQPCLPPATCEEVPDGFVCVAEATFREGPPAEFSGHNASSGS
ALSGLSLVFRTRDPEAGLLRAEDGPAAVWLAVRNGSLAAGVRSGAGLPRAVLPAPGPRVA
DGAWHRVRLAMEQPAAVASRWLLWLDGAATPVSLRGLAGDLDFLRGPGAARVLLAENFTG
CLGRVALGGHPLPLARPRPGAAPGSREPFSARPGAPAPHLGCSGAPVCVPSPCLHGGACR
DLFDAFACACGPGWEGPRCEDRADPCRSAPCARGRCHAHPDGHFECRCPPGFAGPRCRTD
YTGSPTGEALVPSASPVPSLSHFAVICNLGTTAPRVCRRLPVPPEGCSLNITCLNGGQCE
EGPQGANCSCQESFAGQRCQIPCEANPCLNGGTCRAADGVYECVCNARFSGQFCEVVVSD
GRRLEVAVPAACACLLLLLLGLLSGILAARKRRQSEGTYSPSQQEVAGARLEMDSVLKVP
PEERLI
Download sequence
Identical sequences G3MYX7
ENSBTAP00000054766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]