SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054770 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054770
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily FKBP-like 9.43e-43
Family FKBP immunophilin/proline isomerase 0.0000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054770   Gene: ENSBTAG00000032651   Transcript: ENSBTAT00000046345
Sequence length 108
Comment pep:known chromosome:UMD3.1:11:27755440:27756041:1 gene:ENSBTAG00000032651 transcript:ENSBTAT00000046345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVQVETISPGDGRTFPKHGQTCVVHYTGTLEDGKKFDSSRDRNKPFKFVLGKKQVIRGW
EEGIAQMSIGQRAKLTVSPDYAYGSRGHPGIIPPNATLIFDVELLKLE
Download sequence
Identical sequences Q2NKS8
ENSBTAP00000054770 NP_001071437.1.59421 NP_001071437.1.76553 ENSBTAP00000054770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]