SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054898 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054898
Domain Number 1 Region: 2-206
Classification Level Classification E-value
Superfamily L domain-like 2.27e-42
Family Ngr ectodomain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 1590-1683
Classification Level Classification E-value
Superfamily Immunoglobulin 4.49e-21
Family I set domains 0.0093
Further Details:      
 
Domain Number 3 Region: 2278-2371
Classification Level Classification E-value
Superfamily Immunoglobulin 7.69e-21
Family I set domains 0.025
Further Details:      
 
Domain Number 4 Region: 2092-2178
Classification Level Classification E-value
Superfamily Immunoglobulin 9.08e-21
Family I set domains 0.007
Further Details:      
 
Domain Number 5 Region: 1686-1785
Classification Level Classification E-value
Superfamily Immunoglobulin 9.2e-20
Family I set domains 0.029
Further Details:      
 
Domain Number 6 Region: 1783-1877
Classification Level Classification E-value
Superfamily Immunoglobulin 5.55e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 7 Region: 2465-2565
Classification Level Classification E-value
Superfamily Immunoglobulin 8.55e-17
Family I set domains 0.0071
Further Details:      
 
Domain Number 8 Region: 550-644
Classification Level Classification E-value
Superfamily Immunoglobulin 5.85e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 9 Region: 1885-1977
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000108
Family I set domains 0.039
Further Details:      
 
Domain Number 10 Region: 464-551
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000524
Family V set domains (antibody variable domain-like) 0.021
Further Details:      
 
Domain Number 11 Region: 1988-2084
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000766
Family I set domains 0.048
Further Details:      
 
Domain Number 12 Region: 2385-2471
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000101
Family I set domains 0.039
Further Details:      
 
Domain Number 13 Region: 2197-2276
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000156
Family V set domains (antibody variable domain-like) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054898   Gene: ENSBTAG00000022150   Transcript: ENSBTAT00000062954
Sequence length 2566
Comment pep:known_by_projection chromosome:UMD3.1:X:138878690:138902586:1 gene:ENSBTAG00000022150 transcript:ENSBTAT00000062954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACPHPCACYVPSEVHCTFRSLASVPAGISPHVERINLGFNSIQALSETSFTGLTKLELLM
IHGNDIPSIPDGALRDLISLQVFKFSYNKLRVITGETLQGLWNLVRLHMDHNQIEFIHPE
AFRGLTSLRLLHLEGNLLRQLHPATFSTFAFLDYFRLSTVRHLYLAENAISTLPTGMLQN
MPLLENLYLHGNPWACDCDMTWFLQWDAKTKGVLKCKKDKAYEGGQLCSTCFSPKKWHGQ
ELQKLRDVRCQKPSIESPLRQNRSRSSEDDQDEDEGADHPFSPDGFQFPAWNVSVNMSDE
HGNTVHLVCDIKKPTDVYRLHLNQTDPQEIEINATVALDFECPMTRQNYEKLWKLIAYYS
EVPVKLHREPALGKDPRLGYQYRQDADDDSTLYYTGVRAHVLAEPEWVTQPSIELQLNRR
LSSAKLVVLSYSSRHALVMSAKDARLSPSRSWVMIEPGRAVQRAQTVLEGSACQLSCNVR
ASESPSISWVLPDGSVVKAPMEDRDGRFSVLTSGWLKIRSTQPSDAGLYQCIARVRDETD
RMLYRVLVQPPVIQPPDAYTVTIQKNPGEPVTLPCQALAVPEAQISWILPNKRMLNAMAN
ASHAYVLADGTLSIPKVQGSDSGYYRCVAVNQRGSDHFTVGVQVSKKGSRRGGIVEDEGG
SGMGDEENTSKTVLHPQDQEALIRATDDASGGGKKTRKGRRKLKPWKHPTKEPETNVAEG
RRVFESRRRVNVAKKQINPERWADILARVRGRSLPKGTEGPQVITVRAPSLMSSEESSGD
MFVFGEEEQASSAVSSPRTIPLQPGHDGVVHSEPRVTGTRSEEFIDEDSSEKTVGATPTE
VDSNQTPATTLASVLYESSTLQTLEMEHKEPTEENVATDSWSTLHVGSVPEATSPEDESP
MDAVPLAESETVTYFYPDLGTNSQPAEKTVKEQASTRFTPTPASWVAEARTSEPLEDPTL
GDPSIPVETHLQEQTDSPQLVETGLSTPGHPLTPEGMKETSQTLQEEGTLETHPTDSRSI
KGNGQAVHLTTPLDSTLEVVNSVTDFQHPRESMPGVVFGKDMTTAPVTTPAQKDTSPSAL
TTHPSRKRPNGRRRFRPHKFRHRHKQTPHTTFAPTDAFSPPPTQVPEAKTPSLQVASSLV
PTTWVNSAVGTAGRLDTEEHAESVSRGSPHRKQGKKRNRHRYITSTLSSAASVSKPSFSP
EDKHRISFPLSSQAALSPTTVSFTTGDPREITGMGAYSTASISKTYSASDRFQETVPVTR
EPASDGQETKNHGVTDLRDYQTHGLVPGDSVTHAASPSVAEVSPARGFKEVSLTSPFPKT
TSWDPPGATQLGVEHTDPPVTSPSEALTESPSVRESADLGEFSPSAAVSTLFQPQRAAPS
TTLPVLKVEASSSLAETTVRDQGGRETTHTTVRSEIGPQSRVSTPTPLEEPESPFPPTTL
MSSTETTAEPTPPLPSGTSPAWKASKHHVTFHYVGTPETKAPSVNNEVTQHLSKAHQLST
PSSKQDRFTLTPEEALRKWKIPFLYQQDPVFPPVGRYSETSGTQLSSPSVERQKGQRRSP
HSDPLSEHLPTKLFSAGGLPASKFWTLGEKPQIVTKSPQSVTVTVETDVTFPCEATGKPK
PFVTWTKLSTGALMTPNTRLQRFEVLKNGTFVIRSVQVQDRGQYVCTAKNLHGADRMVVL
LAVTAQQPQILASHYKDVTVYLGDTIAMECLAKGTPVPQISWVFPDGRVWQTVSPVEGRV
TLHENRTLSIKEASFQDRGVYKCVASNAAGADSLAIRLHVAALPPVIHQEKAENISLPPG
LSIHIHCTARAAPLPSVRWVLRDGTQIRPSQFVHGNLFVFPNGTLYIRNLAPQDSGRYEC
VAANLVGSARRTVQLTVQRAAANARITGTSPQRTDVRYGGTLRLDCSASGDPWPRIVWRL
PSKRMIDALFSFDTRIKAFANGTLVVKSVTDKDAGDYLCVARNKVGDDFVALKVNVVMKA
AKIQHKEANDHRVLYGGDLKVDCLATGLPNPEISWSLPDGSLVNSFMQADDSGGRAKRYV
VFHNGTLYFNEVGPREEGDYTCFAENQVGKDEMRVRVKVVSEPAAIRNKTYSVIHVPYGD
VVTVACEAQGEPTPRVTWLSPTHRLIPASSDKYQVYQDGTLLIQKAQRSDSGNYTCVVRN
SAGEDRKTVWIHVHVQPPTINGYPEAITTVREVAPGGSRKLIDCRAEGVPAPRVLWAFPE
GVVLPAPYYGNRITIHRNGTLDIKSLRMSDSVQLACIGRNEGGEARLVVQLTVLEPLEKP
VFHDPVSEKITAMAGHTISLNCSAAGTPTPTLLWVLPNGTELRSGQRLHRFFHKGDGRLH
ISGLSSEDAGAYRCVASNSAGHTERLVSLKVGLKPETNKRYNNLVSIVNGETLRLPCVPP
GARGMRLSWTLPSGVVLDGPQVRGRFALWENGTLTVRDASVFDRGTYVCNADGEHGPSVV
SIPVIVIAYPPRITSEPTPVIYARPGSIVKMNCMAMGIPKAEISWELPDKSHLTAGTQPR
VYGNRFLHPQGSLTVQQATQRDAGFYKCTAKNLLGSDSKTTYVHIY
Download sequence
Identical sequences G3MZA2
ENSBTAP00000054898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]