SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055075 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055075
Domain Number 1 Region: 39-302
Classification Level Classification E-value
Superfamily L domain-like 3.27e-42
Family Ngr ectodomain-like 0.033
Further Details:      
 
Domain Number 2 Region: 297-395
Classification Level Classification E-value
Superfamily Immunoglobulin 3.23e-17
Family I set domains 0.025
Further Details:      
 
Domain Number 3 Region: 426-501
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000365
Family Fibronectin type III 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055075   Gene: ENSBTAG00000047158   Transcript: ENSBTAT00000063750
Sequence length 769
Comment pep:known_by_projection chromosome:UMD3.1:18:49288007:49294023:-1 gene:ENSBTAG00000047158 transcript:ENSBTAT00000063750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGPFSSALLSLPPTALPFLLLLWAGASRGQPCPGRCICQNVAPTLTMLCAKTGLLFVP
PAIDRRVVELRLTDNFIAAIRRRDFANMTSLVHLTLSRNTIGQVAAGAFADLRALRALHL
DSNRLAEVRGDQLRGLGNLRHLILGNNQIRRVESAAFDAFLSTVEDLDLSYNNLEALPWE
AVGQMVNLNTLTLDHNLIDHIAEGTFVQLHKLVRLDMTSNRLHKLPPDGLFLRSQGPGPK
PPTPLTVSFGGNPLHCNCELLWLRRLTREDDLETCATPEHLTDRYFWSIPEEEFLCEPPL
ITRQAGGRALVVEGQAVSLRCRAVGDPEPVVHWVAPDVRLLGNSSRTRVRGDGTLDVTIT
TRDSGTFTCIASNAAGEATAPVEVCVVPLPLMAPPPAAPPPLTEPGSSDIATPGRPGANE
SVAERRLVAAELTSSSVLIRWPAQRPVPGIRMYQVQYNSSADDSLVYRMIPSTSQTFLVN
DLAAGRAYDLCVLAVYDDGATALPATRVVGCVQFTTAGDPAPCRPLRAHFLGGTMIIAIG
GVIVASVLVFIVLLMIRYKVYGDGDGRRVKGTSRSPPRVSHVCSQTNGAGATQAPPPPAP
DRYEALREVAAPAAAAAAVEAKAAAADVASAETEAVLGRSLGGSATSLCLLPSEETSGEE
SRAAVGPRRSRSGALGPSASPPPTLALVPGGAPARPRPQQRYSFDGDYGALFQSHSYPRR
ARRTKRHRSTPHLDGAGGGAAGEDGDLGLGSARARLAFTSTEWMLESTV
Download sequence
Identical sequences G3MZS2
ENSBTAP00000055075 ENSBTAP00000055075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]