SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055091 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055091
Domain Number 1 Region: 404-471
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.22e-19
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 580-704
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 1212-1274
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-17
Family TB module/8-cys domain 0.00019
Further Details:      
 
Domain Number 4 Region: 705-831
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.82e-17
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number 5 Region: 1376-1439
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.19e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 6 Region: 794-956
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000282
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 7 Region: 913-1036
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000942
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 357-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000838
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 9 Region: 1023-1123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000111
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 1324-1369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000208
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 288-353
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000589
Family TB module/8-cys domain 0.0026
Further Details:      
 
Domain Number 12 Region: 867-900
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000059
Family EGF-type module 0.008
Further Details:      
 
Domain Number 13 Region: 1607-1652
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000008
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 14 Region: 1116-1153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000238
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 157-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000316
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055091   Gene: ENSBTAG00000004757   Transcript: ENSBTAT00000065855
Sequence length 1658
Comment pep:known_by_projection chromosome:UMD3.1:18:50173268:50202104:1 gene:ENSBTAG00000004757 transcript:ENSBTAT00000065855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPGPSGRRPLLLVLLLPLLAAAATAASAAGPSTSQAVEVAAIPGRPAGAPACRCCPSR
SPRRSRCFRASCRVRSCRPEKCAGLQRCLAPGPPELQSASPSVRKRQVSLNWQPLTLQEA
RALLRRRRPRGPGARALLRRRPPQRAPAGQSRVLCPLICHNGGVCVKPDRCLCPPDFAGK
FCQLHSSGARPPAPAMPGFTRSVYTMPLANHRDDEHGVASMVSVHVEHPQEASVVVHQVE
RVSGPWEEADAEAVARAEAAARSEAAAPYTVLAQSAPREDGYSDASGFGYCFRELRGGEC
ASPLPGLRTQEVCCRGAGLAWGVHDCQSCSELLGNTHQGGAPDGPCPTGFERVNGSCEDV
DECATRGRCQHGECANTHGGYTCVCPDGFLLDSSRSSCISQHVISEAKGPCFRVLRDGGC
SLPILRNITKQICCCSRVGKAWGRGCQLCPPFGSEGFREICPAGPGYHYSASDLRYNTRP
LGQEPPRVSLSQPRAPPSTSRPPSGELVSGGAAPGSPKKGEMIRDTQIKVSNADTPSLPG
FLPTHRPEPRPEPRPGPELPLPSIPAWTGPGIPESGPSAGECQRNPQVCGRGRCIPRPSG
YTCACDSGFRLSPQGTHCIDVDECRRVPTPCAPGRCENTPGSFRCVCGPGFRAGPRGTEC
LDVDECHRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECIQSPGLCGRGVC
ENLPGSFRCVCPAGFRGSACEEDVDECAQEPPPCGPGRCDNTVGSFHCACPAGFRSRGPG
APCQDVDECARSPPPCAYGRCENTEGGFQCVCPTGFQPNAAGSECEDVDECENHLACPGQ
ECVNSPGSFQCRACPAGHHLHHGRCTDVDECSSGASCGPHGHCTNTEGSFHCSCEPGYRA
PVGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEED
LCQSGICTNTDGSFECICPPGHRAGPDLASCLDIDECRERGPALCGSQRCENSPGSYRCV
RDCDPGYHAGPEGTCDDIDECQEYGPAICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQ
DVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETLQGVCGAALCE
NVEGSFLCVCPNSPEEFDPMTGRCVSPRTSAGTFPGAQPHAPASPSLPARPPPPPPPRRP
SPPRQGPVSSGRRECYFDTAAPDACDNILARNVTWQECCCTVGEGWGSGCRIQQCPSTET
AEYQSLCPHGRGYLAPSGDLSLRRATHSPPPIQPIPQPGPPPSLVRRVPLIKRGGGYFIN
HSLHASLDNDECADEEPACEGGRCVNTIGSYHCTCEPPLVLDGSRRRCVSNESQSLDDNL
GVCWQEVGADLVCSRPRLDRQATYTECCCLYGEAWGMDCALCPAQDSDDFEALCNVLRPP
AYGPPRPGGFGLPYEYGPDLGPPYQGLPYGPELYPPPVLPYDPYPPPPGPFARREAPYGT
PPFDMPDFEDDGGPYGESEAPAPSGPGTRWRYRSRDTRGSFPEPEESPEGGSYAGRPAKR
LGRGTEKNSCSGMGHACSRGQVVRKPRTSICNDSEAFVISIVYLLSPDINECDEAEAAAP
LCVNARCVNTDGSFRCICRPGFAPSHEPHHCTPARPRA
Download sequence
Identical sequences G3MZT8
ENSBTAP00000055091 ENSBTAP00000055091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]