SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055180 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055180
Domain Number 1 Region: 560-668
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.53e-23
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 701-773
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.27e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 
Domain Number 3 Region: 152-296
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.92e-17
Family G proteins 0.014
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000055180
Domain Number - Region: 22-117,421-470,604-626
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00738
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055180   Gene: ENSBTAG00000011041   Transcript: ENSBTAT00000064501
Sequence length 777
Comment pep:known_by_projection chromosome:UMD3.1:10:84870522:84912770:-1 gene:ENSBTAG00000011041 transcript:ENSBTAT00000064501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQTSPAEKGLNPGLLCQESYTCSGTDEAVFECDECCSLQCLRCEEELHRQERLRNHER
IRLKAGHVPYCDPCKGPSGHSPGVKQRAVVRCQTCKINLCLECQKRTHSGGNKRRHPITV
YHVTKVQELLEEEGMDEETKRKKMTEKVVSFLLVDENEEIQVTNEEDFIRKLDCKPDQHL
KVVSIFGNTGDGKSHTLNHTFFYGREVFKTSPAQESCTVGVWAAYDPVHKVAVIDTEGLL
GATVNLSQRTRLLLKVLAISDLVIYRTHADRLHNDLFKFLGDASEAYLKHFTKELKATTA
RCGLDVPLSTLGPAVIIFHETVHTQLLGSDHPSEVPEKLIQDRFRKLGRFPEAFSSIHYK
GTRTYNPPTDFSGLRRALEQQLENNTTRSPRHPGVIFKALKALSDRFSGEIPDDQMAHSS
FFPDEYFTCSSLCLSCGAGCKNSMNHGKEGVPHEAKSRCRYSHQYDNRVFTCKACYERGN
EVSVVPKTAASTDSPWMGLAKYAWSGYVIECPNCGVVYRSRQYWFGNQDPVDTVVRTEIV
HVWPGTDGFLKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQ
ILSCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDNCYEARNS
QLDVTEAQGDDEGGTLIARKVGEAVQNTLGAVVTAIDIPLGLVKDAARPAYWVPDHEILH
CHSCRKEFSVKLSKHHCRACGQGFCDECSHDRRAVPSRGWDHPVRVCFNCNKKPGDL
Download sequence
Identical sequences G3N025
NP_001193041.1.59421 NP_001193041.1.76553 XP_005212068.1.76553 XP_010807791.1.76553 9913.ENSBTAP00000014664 ENSBTAP00000055180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]